SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Settu1|171549|estExt_fgenesh1_pm.C_2_t20272 from Setosphaeria turcica v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Settu1|171549|estExt_fgenesh1_pm.C_2_t20272
Domain Number 1 Region: 145-412,444-491
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.42e-78
Family IF2B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Settu1|171549|estExt_fgenesh1_pm.C_2_t20272
Sequence length 513
Sequence
MSEAPVAQPAPAPAADSPAPAASVPAPGEGTSDAPKKLSPAELKKLKQAEKQAKRAQAKA
TGGAPNQQQGPSKDSQKQQKDSKQTSKDEKSRPFPTRQKPAQAHASLAKEPEKKSKKDAG
SKQTGLFFGHLYSQPKQQSLVGASKDVHPAVLALGLQYSSYAICGSIARMVAMLLVFKTV
IEAYQTPPGNSLARHLTSHHLGPQIEFLKSCRPLSVSMGNAIRWLKDVIIKIDPSTPENE
AKRDLIEEIDIFIRERVTAADRLIRDLAATKIQAGDVIMVYAASSIVEQTIVHAHDSGIP
FTVIVVDSKPLFEGKQLARKLANRGITVRYYLVTGASHAVRDATKVFLGAHAMMSNGRLY
SRVGTALISMLAHSHSIPVIVLCQSVKFTERVALDSIVGNEVAPAEEMLSEAERRELLPL
KSRLPASKTDDKSATAEDAPADTADVLKWIEEAKNLHHLQVLYDVTPAHYINMVINEYGS
LPPSSVPVVHRLRTEEQEVAPSKKGVRQTTGWS
Download sequence
Identical sequences R0IR51
jgi|Settu1|171549|estExt_fgenesh1_pm.C_2_t20272 XP_008025799.1.61199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]