SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PFHG_05440T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_05440T0
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 5.62e-45
Family Gametocyte protein Pfg27 0.0000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PFHG_05440T0
Sequence length 105
Comment | PFHG_05440 | Plasmodium falciparum (isolate HB3) hypothetical protein similar to early sexual specific antigen 27/25 (106 aa)
Sequence
KFTEDYIKKIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIRMLFDTYEYVKDV
KFTDDQYKDAAARISQFLIDVVDSYIIKPIPALPVTPDEPHHNNI
Download sequence
Identical sequences A0A0L7KL69
PFHG_05440T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]