SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PFHG_00238T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_00238T0
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-54
Family Capz beta-1 subunit 0.000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFHG_00238T0
Sequence length 292
Comment | PFHG_00238 | Plasmodium falciparum (isolate HB3) hypothetical protein similar to F-actin capping protein (293 aa)
Sequence
MNNDKMEAALNICNTLPGHVFDDTIKMLSRIDQSITNNILINKEGSIKINYDKEENKYYL
GNMFNKEKDSYRSPYTNIYFPEHYINSYVPPEHLRTLEILYNKIFDRYRKAYYMNGLSSV
YLWPNPIEDGFVACFLIKKKEIFDKETNIKWEATHLIQVNITNLNVHYQISCTINFEIKK
NDNLLLSGNINKALENSKKVTDLYLIKDQYFHMENMGYLIECMENSLRKSIEYIYILKIQ
DMLNSIKYYNFTNHLTYNNTNKNISNISNSLIFSRENIQKELQTKIKQVRKK
Download sequence
Identical sequences A0A024VBN8 A0A024VT78 A0A024WDN2 A0A024WWC2 A0A024XE89 A0A0L1I5J4 A0A0L7K6H0 Q8I3T2 W4INM3 W4IVS7 W7FCW2 W7GAV7 W7JTF7 W7K8Y0
5833.PFE0880c-1 gi|124506271|ref|XP_001351733.1| gi|23504662|emb|CAD51540.1| PFE0880c XP_001351733.1.26446 PFHG_00238T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]