SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PFHG_04146T0 from Plasmodium falciparum HB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PFHG_04146T0
Domain Number 1 Region: 85-161
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.22e-19
Family Skp1 dimerisation domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 5-119
Classification Level Classification E-value
Superfamily POZ domain 2.67e-18
Family BTB/POZ domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PFHG_04146T0
Sequence length 163
Comment | PFHG_04146 | Plasmodium falciparum (isolate HB3) hypothetical protein (164 aa)
Sequence
MKNDKIKLVSFEGDEFIVDKNTASMSTVIMNILEVMTAEEDTIPLPNIKTPILKKIIEYM
EYHINNPADEIPKPLITSNLQDVVSSWDFDFVNTDKETLYELIEVKYKQMNIIMASNYLD
IKPLLDLTCGKIASMMKDKTTEEIRAEFDIVNDFTREEEKPVK
Download sequence
Identical sequences A0A0L7KHR1
PFHG_04146T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]