SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Stehi1|118022|fgenesh1_kg.2_#_122_#_isotig11262 from Stereum hirsutum FP-91666 SS1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Stehi1|118022|fgenesh1_kg.2_#_122_#_isotig11262
Domain Number 1 Region: 25-236
Classification Level Classification E-value
Superfamily ITPase-like 2.29e-40
Family Maf-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Stehi1|118022|fgenesh1_kg.2_#_122_#_isotig11262
Sequence length 249
Sequence
MSEKRTPAVLPKALRIPGLNKLHGKRVVLASGSPRRKELLETFGLVPETIPSKFEEDLNP
HDFEDIHEYPVATATHKAVEVYERLVTENPDDGPDLVIGADTVVLTHAQPSTTQTSYSEL
PHTRQELLEKPDNKADCLRMLLDLNGSVCEVVTGVTVIYPILTSPGYAMRSIEERTLVFF
SDNPTYLLEAYADCGEGLDRAGGFAIQGLGGMLIRKVEGDYNNVVGFPTASFFRFLDLLV
EEEDDFLAL
Download sequence
Identical sequences XP_007299670.1.56996 jgi|Stehi1|118022|fgenesh1_kg.2_#_122_#_isotig11262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]