SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Stehi1|167383|estExt_Genemark1.C_5_t10269 from Stereum hirsutum FP-91666 SS1 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Stehi1|167383|estExt_Genemark1.C_5_t10269
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily ITPase-like 6.28e-63
Family ITPase (Ham1) 0.00000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Stehi1|167383|estExt_Genemark1.C_5_t10269
Sequence length 189
Sequence
MSTKPLVFVTGNANKLREVKAILSSGHPIAIESKSLDLPEIQGTTQEVAIEKCKRAAELI
GGPCITEDTALCFEALNGLPGPYIKWFLADLGHEGLNNMLAGFPSKAAWALCTFAYSSGP
GAEVKLFEGRTNGRIVPARGAAKFGWDPVFEAEETGKTYAEMDGEEKNKISHRYRALDKL
REYLKSIDA
Download sequence
Identical sequences XP_007302715.1.56996 jgi|Stehi1|167383|estExt_Genemark1.C_5_t10269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]