SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|69851|estExt_Genemark1.C_3_t10374 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|69851|estExt_Genemark1.C_3_t10374
Domain Number 1 Region: 1-182
Classification Level Classification E-value
Superfamily ITPase-like 2.04e-61
Family ITPase (Ham1) 0.00000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|69851|estExt_Genemark1.C_3_t10374
Sequence length 184
Sequence
MKITFVTGNAGKLREVRQILGAANIDVVSKELDIPEIQGTTAEIAIAKCRRAAELLDGPC
ITEDTALCFEAMNGLPGPYIKFFLKELGHDGLNNMLVGFPTKAAYALCTFAYSAGPKWEP
ILFEGRTDGQIVPARGEGNFGWDACFEPKGFEQTYAEMPAELKNQISHRGRALEILVKYL
RTLE
Download sequence
Identical sequences jgi|Trave1|69851|estExt_Genemark1.C_3_t10374 XP_008035454.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]