SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|72871|estExt_Genemark1.C_7_t20326 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|72871|estExt_Genemark1.C_7_t20326
Domain Number 1 Region: 33-245
Classification Level Classification E-value
Superfamily ITPase-like 1.11e-40
Family Maf-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|72871|estExt_Genemark1.C_7_t20326
Sequence length 258
Sequence
MNFFSSKKVELPKHNPVLAYALQIPALQKLVGKRVIMASNSPRRREILQTFGLAPEVVPS
TFEETLPFGGFQDPHEYPVATASHKAVEVYERLVTEDPDDAPDLVIAADTVVLTHPLPGL
SSIPRFEDEAPFPQDILEKPIDKDDNMRMLLDLNGGVCEVVTGVSIVFPVLEAPGYKIKS
IEERTLVYFAENDRHVLEAYVGSGEGSDRAGGFAIQGLGGLLVSKIEGDYNNVVGFPATS
FFKFLDLLIEEEVDFLSD
Download sequence
Identical sequences jgi|Trave1|72871|estExt_Genemark1.C_7_t20326 XP_008039942.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]