SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|141971|estExt_Genewise1.C_2_t40379 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|141971|estExt_Genewise1.C_2_t40379
Domain Number 1 Region: 104-505
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.06e-103
Family Pyridoxal-dependent decarboxylase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|141971|estExt_Genewise1.C_2_t40379
Sequence length 547
Sequence
MSTLVPRANLPGLSPFGRTVWENVKTAVVAYLIVTRVIKAGRHLRARGLVRSVTDIYRWV
LQESLLLALRFPTARKKVETELGKARLDIEAKLVPQGPGVTRHLSLPASGHDTTWILAEM
AKMDQESGNHVDWRDGKVSGAVYHGGDDMSKVIMSAMERYCLSNPLHPDVFPAVRKMEAE
VVAMVLKMYNNPNGAGTTTSGGTESIIMAVKTYREWARATKGITEPEIVIPISAHAAFDK
GAAYLGIKVHTIPVDPETRQVDLKHVRRAINANTIMIVGSAINFPDGNQDDIVALGKLAT
KYKVGLHVDCCLGSFIMPFLEEAGFPVQPFDFRVEGVTSISCDTHKYGFAPKGNSVIMYR
DAALRRFQYYVNPDWVGGVYGSPSIAGSRPGALIAGTWAALQYMGHAGYLESCKSIVSAA
KTIAKRITAEIPELRILGNPPASVVAFAAAHGNPLNVLEVGDAMSRKGWHLNAISNPAAV
HIAVTRLTLPVVDTLIADLKDAVNEAKLAPSGSGTMVMLYGLGQSSPVGSTMVGHVAEAF
LDTMYKA
Download sequence
Identical sequences XP_008034485.1.43472 jgi|Trave1|141971|estExt_Genewise1.C_2_t40379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]