SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|170005|estExt_Genewise1Plus.C_7_t40264 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|170005|estExt_Genewise1Plus.C_7_t40264
Domain Number 1 Region: 274-347,374-583
Classification Level Classification E-value
Superfamily SPOC domain-like 1.04e-59
Family Ku70 subunit middle domain 0.0000855
Further Details:      
 
Domain Number 2 Region: 27-244
Classification Level Classification E-value
Superfamily vWA-like 1.4e-37
Family Ku70 subunit N-terminal domain 0.001
Further Details:      
 
Domain Number 3 Region: 610-658
Classification Level Classification E-value
Superfamily SAP domain 0.00000000244
Family SAP domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|170005|estExt_Genewise1Plus.C_7_t40264
Sequence length 663
Sequence
MAPYDDWNKDDDEDEELQDPSLYESKRDVILFCIDCSPSMLEMRDDERYEDVQTCNLMVA
LEAAMQIQKKKVLVGPNDAVGIVLFNTTKRNDNADDSTDVKKGTYVYQPLATIDAPKVME
LVQLLDEAREKPDFLRKTFPPMTDKRIAVGDVLTSCNWVMRDGAPKTATKRIFFITDEDD
PHPGPSGHRFITSARTTLIDLMQTGVTVEPFFIGTEDKPFDPAKFYSSVLLPTNLTDLDD
ISDGDPGSILPESISITRVEELLAQMRFHEVPKRALFSVPLTLAPGFMIGVKGYGLITEQ
KKGAYRYFADLGDRMEPVTSRAAYVDEDRDAEADKAEILYGMDLGAPSAEVDGEEGQDAK
TSDVGTRAVQLGSRVFYTADEVRSFRTLGLEPGIKLLGFKDRSELAFEDNVKHSVFVYPD
EMTYSGSKRTFTALLRTMIKKEKIAIVLALMRRNASPVFCAVLPQAEKVDESGWREPPGF
HLIPLPFADDIRAASQQKGFRASTELVAAARKWIEKLKVKNGSYPPDSYPNPALAYHNTQ
LEASAFREDFDPDAFEDLTVPKLDMMHKRAGKLIEEWKQALVEDDTANIVAAPPTTGRKR
KAETQDVAVDEAEVRRLYDGEQLHKLRVEDLKNFLKSKSEPVSGKKADLVERVADWLDAH
PTG
Download sequence
Identical sequences XP_008039943.1.43472 jgi|Trave1|170005|estExt_Genewise1Plus.C_7_t40264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]