SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|27324|fgenesh1_kg.3_#_473_#_isotig04412 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|27324|fgenesh1_kg.3_#_473_#_isotig04412
Domain Number 1 Region: 157-568
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.81e-102
Family GABA-aminotransferase-like 0.00000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|27324|fgenesh1_kg.3_#_473_#_isotig04412
Sequence length 672
Sequence
MDKLANLAKFKATCPYLGRTKTSTLRTLCTSASPRFPAVSKLTEKATKCPVMGPALHVRS
TQMVAGYASLAGSAEFAKIPEHQGINNPSPADAQKCPHASKALAAARMAEDLVHAKKAKA
AKAAAAAKPAAAAPASCPFASTSEAKPKAATPGGFDYERFYADELEKKHQDASYRYFNNI
NRLAHKFPIAHTGNVKDEVEVWCANDYLGMGNNPVVLETMHRTLDSYGHGAGGTRNIAGN
TGMHLALEEELATLHRKPAALVFSSCYVANDATLATLGTKLPGCVYFSDTMNHASMIQGM
RHSTAKRVLFKHNDLQDLEMKLAQYPKETPKIIAFESVYSMCGSVGPIKEICDLAEQYGA
LTFLDEVHAVGLYGPRGAGVAEHLDYEAHKAAGQSGEPIPRSIMDRVDIISGTLGKAYGA
VGGYIAGSNDFVDMIRSYASGFIFTTSLPPANMAGARASIAYQKEFNGDRQLKQINVRDL
KSRFVAMDIPVIPGPSHIVPVLVGDPTLTRLASDKLLAEHNVYVQAINYPTVARGEERLR
FTVTPGHNVEQIARLSRAVDQTFTELGIKRTSDWRKLGGHAGVGVADAKPVEPIWSDEQL
GLTDGTAPAVLHPGQKRFVDPRAVRITREKFNDLLGPYTEPLAKVDALNADLTLAPAPLT
AASVTAEVSASA
Download sequence
Identical sequences jgi|Trave1|27324|fgenesh1_kg.3_#_473_#_isotig04412 XP_008034838.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]