SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|29876|fgenesh1_kg.7_#_533_#_isotig04263 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|29876|fgenesh1_kg.7_#_533_#_isotig04263
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000141
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 56-97
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000717
Family Zn2/Cys6 DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|29876|fgenesh1_kg.7_#_533_#_isotig04263
Sequence length 841
Sequence
MRSHTGDRPYKCQHCGDQFARSDLLSRHINKCHASEKPPTTTAPSRRKGTAAASRATTSK
QACDQCVTSSLPCDGANPCTKCVQRKCRCTYVKFHRQTAPAGPGHPAPPTIPQNIPGRHA
ISLGAPRLPDEFLLAPPPGTMNLSSLYATGPAHQYPIQHPSLYAQDYASLPPLASALAHS
ESLASGMLPAHTREALENDPDAMARYRAQAELLTRAAIHNGNMGIAQPAPSADASGSLPG
LYAAAGAQDGQYTRYNLPPPSQWDPPIAQNQYQQRQKEYEPQYGNRTQTHSVSPPYATGG
EPSLQSHPPVASTSSSYEASAPSNYHHSNLPPAGTLYPPQHSQGHHSHHGHSRSEDLSGS
GDDFGSDAGSTGTGPSHSIPSSTNSSSVHLPLPGFNHLRTKADFGSKDGYEQPRYPSEQG
QSGQSQSQNPQEGEGGFSSAFGLMSLDDPNVLAGLANDGAPFFSGLTPNGASNNPTGLSL
ATPTQDLLAQLKSAGGREALESKEMRDFWKMYLRTPLTGPNAGGGLMFPLQTPTGPGVQL
GHAMSSQGGRPSPSRRHSRVSSLPSMKTPPLFADERLGSVYNRGQEHYDSHGHASQSQGQ
QGGVTGAYNSTVRTTLHDAEDLKSYEQAVLARKAPMQLNLVPKRKGSTTTGPGPSANAMG
KSKSMSPVVPHATYNGPSSSNAGQDMGSGSSRISELLNRPASSSSAGTTNSSGSGLSLPS
NASTANTSQASSSLAHAFGGASSSERPSTSDGVPLSHSPPQQHLVEWGAPTYRPSFKRIA
SQTLGPDNAKRALLGPAGWDHDEEDEDDAVPEEEEEDEEPHPRMPMGAPGEGRRMSLPTQ
S
Download sequence
Identical sequences XP_008039192.1.43472 jgi|Trave1|29876|fgenesh1_kg.7_#_533_#_isotig04263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]