SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Trave1|73497|estExt_Genemark1.C_9_t10235 from Trametes versicolor v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trave1|73497|estExt_Genemark1.C_9_t10235
Domain Number 1 Region: 31-497
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.74e-124
Family Pyridoxal-dependent decarboxylase 0.0000000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Trave1|73497|estExt_Genemark1.C_9_t10235
Sequence length 538
Sequence
MLAKHLNPDQLIEAAKDNGKGHGIHIHSSTNHHSVNAYGARYGTEPIPKYRLPSKGVDAE
TAYQVIHDELALDGAPALNLASFVNTWMPKQANQLMMENISKNFIDQDEYPMTQAIHTRC
ISILADLWHAPSTQQAIGTATTGSSEAIQLGGLAMKRIWQEKRKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFDVEARLVPVSEESHYRLDPRRAMEYVDENTIGVFIILGSTYTGHYE
PVKEVSDLLDEYEARTGHSVPIHVDAASGGFIAPFASPALEWDFRLPRVVSINASGHKFG
LAYVGVGWAVWRAQELLPKDLIFELHYLGSVEYSFSLNFSRPAHPVIAQYFNFVHLGRAG
YRAVALQDMQNARLLSRALEGSGMFTVLSDIHRPADKLAATIKATVGFDEEDIDNYVPGL
PVVAFKFSDEFRTKYPDVQQKWVQVLLRAKGWIVPNYELPPDLQATEILRVVVRENTTAT
MVDRLVADLIEVMEGLAKADSPMHALAVLGGRKSVESHHGRLEEGSGSKPSGTYARQC
Download sequence
Identical sequences jgi|Trave1|73497|estExt_Genemark1.C_9_t10235 XP_008041384.1.43472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]