SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501146546|ref|YP_007986884.1| from Lactobacillus plantarum subsp. plantarum P-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501146546|ref|YP_007986884.1|
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-77
Family Protein kinases, catalytic subunit 0.00000595
Further Details:      
 
Weak hits

Sequence:  gi|501146546|ref|YP_007986884.1|
Domain Number - Region: 496-557
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0245
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501146546|ref|YP_007986884.1|
Sequence length 653
Comment Serine/threonine protein kinase [Lactobacillus plantarum subsp. plantarum P-8]
Sequence
MANVYLAHDLILDRDVAVKLLRLDLRDDPKTIKRFQREALATTELVHPHIVSLYDIGEEN
GMQYLVMEYVKGMDLKNYIKENFPLPLQQVIDIMEQILSAVATAHAHNIIHRDLKPQNIL
IDEQGNAKITDFGIAVALSEHTMTQTNTILGSVHYLSPEQARGSMATKQSDIYSLGIILY
EMLTGSVPFKGETAVSIALKHFQNAMPSVREFDADIPQALENVVLQATTKDPRERYATVE
DMATDLLTVLASSRAGEKRFVPQDVGNDETKIMPSADIQAAIAANQDGKTQVVAHKSKQP
TLQRPAETTESQTDADEEPLPTRSWSKRHPLRRRLLFWGGIILLLVVAVIVGLELSRPQM
TTVPKVTGLSQRAATKVLKKHHLTVGTVQHAKSNQVAKNQVIKSTPSVKTRVQERARINL
VISNGAKVMSFGNYVNDNYHDVRQTLKSAGFKVKETYSTSSVAAGQIISQDVVAGSRVMP
TDTTVTFTVSAGSRYVELKDLTGESKSDILDYAEANDLNVNFKQGYSSEQKAGYSYDQDP
DGGGNVRTGSTITVTMSRGSDNNVTTPQNFYVKLTVPYKALSATTAQANDVKIYLYDDTH
MIETVYRDIAIMRSTKISLPFQLTGNTKGHYRIVRNGVTIMEKKNITSKNATK
Download sequence
Identical sequences gi|501146546|ref|YP_007986884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]