SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|501145766|ref|YP_007986104.1| from Lactobacillus plantarum subsp. plantarum P-8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|501145766|ref|YP_007986104.1|
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-56
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 2 Region: 339-435
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000314
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|501145766|ref|YP_007986104.1|
Sequence length 448
Comment tRNA(Ile)-lysidine synthase [Lactobacillus plantarum subsp. plantarum P-8]
Sequence
MTPIQKFNRQLAAAKLLSPQQTVVVAVSTGVDSMVLLHLLQRLPAVERPRVVVAHVNHHL
REQSQMEADYLRQYCQQQNLKLVMADWLPAAHPKSGIEAAGRQFRYHVFAKVMRENRATA
VLTAHHANDQVETYLMKLARGGDISQLTGIATSRPFATGRLIRPLLTWSKDQLRNYAAEQ
HVVYFEDVTNQDVALTRNRIRHRVVPELMTVNPQLLKHVADYQQQLTTLLTAKKQMVTVL
LSQVVTATGALVVDQWGALPSQWQLAVFATWLEQQTQQLFTESKLQPLVSWGQRTRPATS
RLTVNAAWELYRNAGIIEALPIKKRGKKLMPREKIMVDLNQWQKITATQTVGIFTRVPNV
VSQPFWLTEADWPLVWRPWQAGDRIVLKGGGHQLVRRLLIDRKVPAERREQVQVLVNAQG
NVLWVVGHKFSYRTTGTQTVFLALKHES
Download sequence
Identical sequences WP_015639980.1.37302 gi|501145766|ref|YP_007986104.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]