SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mellp1|50546|estExt_Genewise1Plus.C_630011 from Melampsora laricis-populina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mellp1|50546|estExt_Genewise1Plus.C_630011
Domain Number 1 Region: 660-788,820-1012
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.98e-63
Family p120GAP domain-like 0.00081
Further Details:      
 
Domain Number 2 Region: 6-156
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-34
Family Calponin-homology domain, CH-domain 0.0000204
Further Details:      
 
Domain Number 3 Region: 1256-1348
Classification Level Classification E-value
Superfamily RGC domain-like 1.57e-22
Family RGC domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Mellp1|50546|estExt_Genewise1Plus.C_630011
Sequence length 1363
Sequence
MLETQRHLLQAYEYLCHVGEAKQWLEARLSVTELEQTLRDGVILARLARRFLGHQAVPRI
FINPKLQYRHSDNINYFFRFVRHVGLPELFIFELVDLYNAKNLPKVIYCIHVLSHLLAKR
GMAARIANLVGKLEFSNDQLEQTNAGLVGKSMPNFGNINKELAKEINEEPEVELESESER
QDRELLELEPEITCLQAQCRAHLARARYENLQSSLHQNISITIALQAARGHLTRQRISKM
SHLLERLDFLWTGLQAHARGALVRARHHQLCVAVNRVSSEFVGLQALVRARAVRQNVRER
QKHLESNDTSSSVASLQARIRGLLSRRRFFEPIHRLDQYEHSIIGFQSHIRARLVQLSLA
DRVTHLLAAEDDFVGLQAMARGLLSRRALLGLVKDLQSVEAEVTGFQAVCTAVLVRRAHA
QKAKALHKMEVRRGVGGLQAFVRAGMVRKKIENQKKELDFVAPDVVGIQAQCRGVLARVE
WGTWFEHIRNNGAEGAIYLQRLARGLLVRRQFFERLMHYHEHLQKVVKVQSVFRARQAAT
QYRHLQRNTNVPMAAIKAFLHLLNDSDADYEEEITLAGLRATAVRAIRENQELESHVGEL
DTKIALLVKNKISLDELQRVRGGMNGRRREMAGRNSVLAAANDPFAAVNLLDKQARRKLE
CYQQFFYLLQTKPEYLARLLYLIKGCEDKVIKVVEGVVLTLFGYAHMRREEFLLLKLFQR
SIHEELAGVNSLSEFVMGDFMFVKLMVQYGRGTKERKYLKDLLSPVICEIVKDDELNVET
DPIKIYRSVINEEETRTGIQSSRPLNVTFNQALADQETCALFIKHLQSLRALTDRFLYAI
TESTKRMPYGIRYIAREIFRGLQVKFDSEPEEALVKVVLHMIYYRYLQPAVVAPETYDVV
NSVIGPLARKNLSEVSKMLNQISVGRLFSDENPYLVPLNEYVVHAMEKFSNWLYDMIEVE
DAEAHFAVDEYLDHTVSTKPTIYISPNEIYAMHSLILGDLDRIAPAPEDSLRALLIELGG
APSAASAELDQARAAEIALNLENKLTVNQDPEADIKALWVKTKRYVLAMLKVQPGTTLMN
AFLEPVNEEHEDEWARIVMEEVEWEKNTRGRRASRMVESNHLRSLNTLEDVHSLSFQELK
ARTLENVLQLEQLGKLSREDNYQGILDSLAKDILQRNRRRIQRRADMSMITNTLSHLEEK
QKYLEEQEGQYNSYISDSMAGMQKKGSKKKFVMPFTPQWHHLRSLEKKGGRKPAFGSYKY
SAQRLYEKGILLSIDQFSPKQFDKVSLIISCDEVGVFKLEAQYLDEPVRNGSVQLRMEDL
LEDQFSGKQSVKLEVAKLNLNLLLYLIKLSIFTSLSFKADEVC
Download sequence
Identical sequences F4S5T4
jgi|Mellp1|50546|estExt_Genewise1Plus.C_630011 XP_007416735.1.63152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]