SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Mellp1|65615|fgenesh1_pg.C_scaffold_35000123 from Melampsora laricis-populina

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Mellp1|65615|fgenesh1_pg.C_scaffold_35000123
Domain Number 1 Region: 15-390
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.61e-88
Family IF2B-like 0.000000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Mellp1|65615|fgenesh1_pg.C_scaffold_35000123
Sequence length 460
Sequence
MLCSIRIPNGKSLEETRSVEIIDQLILPHELKWCKVSNTNEAFEAIKSMKIRGAPAIGSI
AALSIACELLNYLELTKTGNTNNENNPLENTLKLQNYLEKTSQHLLSARPTAVNLREALL
RVAQAFHKIHEQGGERDPKKITEKLVAVCKAVWEEDLERNKKIGYNGARWLINKLGISDR
PERKISMLTVCNTGSLATAGFGTALGVITALHELGRLEHAYYMQTGPYMQGARLTSLELQ
TLKIPSTMVCDTAAGWLINSGRVDAFVAGADRIASNGDTANKISTYQISLMCRHAAPTSK
SIPVLIAAPLTTFDLNMESGVEIVIEERPSIEACTVRGKVISEPGSTSRSNEVATVLITP
EGTQALNPAFDVTPNDLISGIVTELGVAERGHSSFDLREHAKGGSSHSTDGQSQAELQIA
SQVQNLQAKYNATAAAYKDNTGHDLLQGGIEGREPVNPAK
Download sequence
Identical sequences F4RW30
XP_007413275.1.63152 jgi|Mellp1|65615|fgenesh1_pg.C_scaffold_35000123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]