SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384209997|ref|YP_005595717.1| from Brachyspira intermedia PWS/A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384209997|ref|YP_005595717.1|
Domain Number 1 Region: 94-187
Classification Level Classification E-value
Superfamily Ribosomal protein L6 5.76e-31
Family Ribosomal protein L6 0.0001
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.8e-20
Family Ribosomal protein L6 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384209997|ref|YP_005595717.1|
Sequence length 190
Comment 50S ribosomal protein L6 [Brachyspira intermedia PWS/A]
Sequence
MSRLANKPIAIPQGVEVKIDGHKVIVKGKRGELTREFFDYIIFELENNSLWVKPPKIEST
DEKAIKENKAKYSAQLGLVWKLISNMIEGVTNGYKKVLQLEGTGYRSNVQGDTITLQLGF
SSDVKMKIPEGIKVTVEKDTKITIEGNDKEQVGELAMNIKKKRPVEPYKGKGVRFDGEHV
KYKESKKAAK
Download sequence
Identical sequences G0ENQ7
WP_014488938.1.89931 gi|384209997|ref|YP_005595717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]