SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384208226|ref|YP_005593946.1| from Brachyspira intermedia PWS/A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384208226|ref|YP_005593946.1|
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.7e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384208226|ref|YP_005593946.1|
Sequence length 108
Comment phosphotransferase system cellobiose-specific component IIA [Brachyspira intermedia PWS/A]
Sequence
MTQDYETFMEENVFPIIALAGESKSLAYEALRLAKENKFEESDKKMQEADKLLLESHQYQ
TDLISKEANGESFVINLLFIHAQDHLMTAISEKNLIKELIDILKINHK
Download sequence
Identical sequences G0EKQ8
WP_014487206.1.89931 gi|384208226|ref|YP_005593946.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]