SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449662690|ref|XP_002164316.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662690|ref|XP_002164316.2|
Domain Number 1 Region: 166-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.19e-27
Family RecA protein-like (ATPase-domain) 0.049
Further Details:      
 
Domain Number 2 Region: 11-105
Classification Level Classification E-value
Superfamily DNA primase core 0.00000549
Family Primase fragment of primase-helicase protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449662690|ref|XP_002164316.2|
Sequence length 430
Comment PREDICTED: twinkle protein, mitochondrial-like [Hydra magnipapillata]
Sequence
MGFKKIFFKNQEQTLIGNREDLNLFGWQCIASGQKEVVLTANELDCIAVKWATGVPCLAL
PTSNLPPSLLPFLEQFDRITFWFPNNYQSRQNVLHFTKKLNMLRCFTTGKNVESPLFCLE
YGKDFMKKTLQESWCMTIDRLLTIKDIGDELFNELTHAKENAGVAFTRFPLLNDFLKGHR
RGELTIFTGPTGSGKTTFLSELSLDLCMQGINTLWGSFEIKNVRLANIMLHQYSGIALEK
HMDKFSKWYECFENLPMYFMSYYGAQDLHSVIQTIEHSVYMYDIEHVIIDNLQFMTTISN
DDDRFQALDKAISLFRKCASELNIHVTIVVHPRKENDDSILQTASVFGTAKATQEADNVL
ILQKTDNLIMQVKKNRFNGTVGTIPLCFNPDSLCLSGFFRNVETGEGVLPELKPIRPIQN
LTAARRSKKI
Download sequence
Identical sequences gi|449662690|ref|XP_002164316.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]