SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449668814|ref|XP_002160378.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449668814|ref|XP_002160378.2|
Domain Number 1 Region: 1-29
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.00000000889
Family GAS2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449668814|ref|XP_002160378.2|
Sequence length 284
Comment PREDICTED: uncharacterized protein LOC100209068 [Hydra magnipapillata]
Sequence
MVRVGGGWETLTEFLEKNDPCKAEGRTNFEVREEFILPEGASQSVQAFKSKMSQQITRET
SKSKIPSLPRESSSSRISTPPINRKKSDLEKEGKSIPTFGTKDYSGVKSHGYGITHNIQK
KKRDTPESVTRTPSQSKITREISSDVYKRLYSSPSSKTAKSSVVSPKTATTTTKVGPKIS
TTSKSEVTTDSAKSLKKADKKEVGNEPNSTSGASGTEMPAEKTKTTRKSISGATQSSKSS
GVFDRLSASHSKVSSGKQGDDEKSGTSIQKKTDTVTKSKLPIKK
Download sequence
Identical sequences gi|449668814|ref|XP_002160378.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]