SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449673423|ref|XP_002163874.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449673423|ref|XP_002163874.2|
Domain Number 1 Region: 17-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-23
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|449673423|ref|XP_002163874.2|
Domain Number - Region: 201-236
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.00222
Family GAS2 domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449673423|ref|XP_002163874.2|
Sequence length 239
Comment PREDICTED: growth arrest-specific protein 2-like [Hydra magnipapillata]
Sequence
MPTLEDEDYFMVQINERNEKSLIPLMEDVAEWLSTYICLDINVNNFLDMLDDGVALCMLA
IKIQKLSKESKVKSKILSNEAYIIPEVLPPFEFNFHHQVKKKSFFARENAENFLKWCRKI
GIRDSTLFVSEDLVLHKQTKNIILTLLELGRIVHRYGIEVVPSIVNLEIEIEEENQNSFD
WMRNVTIRKKKRCKTLDLDAKVQRCARKYNVAVEKISEGKYLINKKLSVFIRVCNYFVF
Download sequence
Identical sequences gi|449673423|ref|XP_002163874.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]