SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449676796|ref|XP_002161584.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676796|ref|XP_002161584.2|
Domain Number 1 Region: 4728-4884
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-21
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 2 Region: 4197-4345
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-19
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 3 Region: 5227-5302
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.02e-17
Family GAS2 domain 0.00057
Further Details:      
 
Domain Number 4 Region: 4406-4561
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-17
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 4838-4994
Classification Level Classification E-value
Superfamily Spectrin repeat 8.2e-16
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 6 Region: 4624-4778
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000011
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 7 Region: 4947-5117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000288
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 8 Region: 4079-4234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000655
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 9 Region: 3560-3704
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 10 Region: 3477-3594
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000249
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 11 Region: 2029-2147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000374
Family Spectrin repeat 0.018
Further Details:      
 
Domain Number 12 Region: 3777-3908
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000041
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number 13 Region: 2597-2715
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000158
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 14 Region: 2164-2300
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000023
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 15 Region: 2903-3056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000192
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  gi|449676796|ref|XP_002161584.2|
Domain Number - Region: 3372-3484
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000162
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 2379-2470
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000512
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 2686-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00576
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 3011-3163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number - Region: 2489-2577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0403
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449676796|ref|XP_002161584.2|
Sequence length 5431
Comment PREDICTED: uncharacterized protein LOC100214026 [Hydra magnipapillata]
Sequence
MKLIHDVAETSSPLISNLKEDPLDKIIESIPAYESNIVHTVLRTVHRKPLNVPSLRSVYR
KVIVSEIEEDKINVDIPVHSVINEEVLIETTNISVQEHIPDLISELADLSEDEINVRQVY
RKCSYHLEDPLDTDVSDNGVVKPNLPLVVDIKDDRFDESVDSIPSPESDIDYVVLRTVQR
KPINVPTLRQVYRKDFLSVIEETTMNVVIPEHTVINNEDVIETTNISIQEHIPDLISEVD
DLYEDEIDVRQIYRKVSRHLIEADDTLILDKIIESIPAYESNIGHTVLRTVHRKPLNVPS
LRSVYRKVIVSEIEEDKINVDIPVHSVINEEVLIETTNISVQEHIPDLIFELANLSEDEI
NVRQVYRKCSYHLKEPLDNDVSDNGVVKPNLPLVVDIKDDRFDKSVDSIPSPESDIDYVV
LRTVQRKLINVPTLRQVYRKDFVSVIEETTMNVVIPEHTVINNEDVIETTNISIQDHIPD
LISEVDDLSEDEIDVRQIYRKVSRHLIEADDTHILSHDVAETSSPLISNLKEDPLDKIIE
SIPAYESNIVHTVLRTVHRKPLNVPSLRSVYRKVIVSEIEEDKINVDIPVHSVINEEVLI
ETTNISVQEHIPDLISELADLSEDEINVRQVYRKCSYHLEDPLDTDVSDNGVVKPNLPLV
VDIKDDRFDESVDSIPSPESDIDYVVLRTVQRKPINVPTLRQVYRKDFLSVIEETTMNVV
IPEHTVINNEDVIETTNISIQEHIPDLISEIDDLYEDEIDVRQIYRKVSRHLIEADDTLI
LDKIIESIPAYESNIGHTVLRTVHRKPHNVPSLRSVYRKVIVSEIEGDKINVDIPVHSVI
NEEVLIETTNISVQEHIPDLISELANLSEDKINVRQVYRKCSYHLEEPLDTDVSDNGVVK
PNLPLVVDIKDDRFDESVDSIPSPESDIDYVVLRTVQRSPRTSSPLISYLKEDPLDKIIE
LEEDVELSCRRVVRVLTKVSIVSPLVIPYDFGRQVIINRTIVLPNEIDLSSQFSNNLKDN
NNLEVLDSISSNMSVILTLRTVQRKPINVPTLRQVYRKDFVSVIEETTMNVVIPEHTVIN
DEDLIETTNISIQEHIPDLISELADLSEDEINVRQVYRKCSYHLEDPLDTDVSDNGVVKP
NLPLVVDIKDDRFDESVDSIPSPESDIDYIVLRTVQRKPINVPTLRHVYRKDFVSLIEET
TMNVVIPEHTVINNEDVIETTNISIQEHIPDLFSEVDDLSEDEIDVRQIYRKVSRHLIEA
DDTHILDKIIESIPAYESNIGHTVLRTVHRKPLNVSSFRSVYRKVIVSEIEEDKINVDIP
VHSVINEEVLIETTNISVQERIPDLISELADLSEDEINVRQVYRKCSYHLEEPLDTDVSD
NGVVKPNLPLVVDIKDDRFDESVDSIPSPESDINYVVLRTVQRKLINVPTLRQVYRKDFV
SVIEETTMNVVIPEHTVINNEDVIETTNISIQEHIPDLISEVDDLSEDEIDVRQIYRKVS
RHLIEADDTHILGHDVAETSSPLISNLKEDPLDKFIESIPAYESNIGHTVLRTVYRKPLN
VPSLRSVYRKVIVSEIEEDKINVDIPVHSVINEEVLIETTNISVQERIPNLISELADLSE
DEINVRQVYRKCSYHLEEPLDTDVSDNGVVKPNLPLVVDIKDDRFDESVDFLPSPDADND
YVVLRTVQRKPINVPTLRQVYRKDFVSVIEETTMNVVIPEHTVINNEDVIETTNISIQEH
IPDLISEVDDLSEDEIDVRQIYRKVSRHLIEADDTHILGHDVAETSSPLISYLKEDPLDK
IIELEEDVELSCRRVVRVLTKVSIVSPLVIPYDFGRQVIINRTIVLPNEIDLSSQFSNNL
KDNNNLEVLDSISSNMSVILTLRTVQRKPINVPTLRQVYRKDFVSVIGETAMNVVIPEHT
VINDEDVDLGRSYFKAAKVTLSFYGTPDYFHVYHKQSKKARNFYQCKNILYFVMSGNDTN
LKYSEIFICNSARYKSKIVIYIKPRKDIRKKYHIFIHWLFQQSLVQKEPEYDNIIQNGLK
LLEDIHSLQEKNELYKQLEKITKDWDDINKASSKRQFDIDKLHLICRKYNCEYVTFNIYL
TKVENQKDEFKPVSTDKILLQKQLAEAEQFYADVNENRSVYNNFITANESIFITCKELDI
TDGLTEMFNQVELVKEKWTNLNSYACNRLHLCKETLQLLEDFDKKLNPIEMLIYEVNFYA
NQYHLFGDDVNQAESILVEIQEVEIQLTKYKADIDCAEKNTAVIIEVNKNDEKLCSNVAI
NLSNLRKSFKSLANKISEKLNTMVTVKLCYENFMELKAPIEQLITSSVLLDRNLLPIEVN
VDNEQIKLLKDLIAKLEDRKSDLKSTNRVGLKLIGYLDNSENVERTLESLNDSYFEVIDK
LKGKVNIINEHCYKVNIFNSLIDGIKAWVVECQHFIESFVMPKIDIENVNKQIEVIQNNL
KNHRKYVLMLKEAQMIKNCSFNDYKIIFPSVEKQLKMVEKPMDDISEKLSELENQLFVSL
TFCKQYSFDESECTQWLIKTENELKKQKPISAKNDINCQQLVIQKNLVEDVQLKSLQFEV
FFENVGDQNTADVNKTAIFNRWFEIKQNVNKREKCLNEVVHLSEKFEGLFSIVVPWLNNA
KKTCDVLTSIPVKPNKLLKQISSVDEMIAQVAVKKPIIKDFNDCFRELEQKAECDIEDIS
DIVNCTLMQFKGLENNLLNISHRAKKMQEKIEIFKTMQNNIEELCSEVHSTCDKIKPHDV
EEANIEKDVLQMFLTDISNKKLDIDLLKQMGNELILIDNQNVNIITINETVMSVEKKVCD
AIFKIKNMLENIEKFSNDVVKFQNILFSAKMKSDELIKNSNAINSTGSTREIIKTQLSEI
NDIQNELKNVYNDFLQAEALADEIFARRNKDQSTYDRLQSQLQDTKKLLKINESLADSCE
QKLRTKLKSCGDLQDLAENLLYKLKAIQLNIDQHIIKDLSINPDNIRKNIYSLQNLKNDI
ENQELTCKEVLQNLNVLMANMENSAELVVLKSKSDELKDLWESVNNKVLHEITKLESVHF
NAADLDLKVKNMGMFLIAKQKQVDCFLVDIPCVADDLYLYQTKVDDVTKSLQVHYQDIVE
IKDLIASLESICQNDILDIQICIDKFEVHYFELKKRCTEEQSEIDKMFQKINFFNDILLK
STKVLKEIEKEVYDATIFKANKFQITEVNHKLNDIEIKTNELFVSISELNVICADIKKVN
NSFQDNDLNDLSLKLKNLQTLISEKRNDLKNLLNYWDNALLLKEKIVDDFSAIQTDILQC
EPSIFSAEAITSHLEILNTCKFKIDIVEEHVENLTNNSFFSYKEVDIELFEGICSLEKQI
KSFKTKIVEKEQLLNKLKDKCCAFFGLFDEVSAKLTNLENKISFLDINNNDKDVNDKQIQ
EVKDLNTELDRIKESVTKLNINEKKIGNKYPELSLEKAKSLLQTLNDKVALVSIDLFNRQ
SKLEISLQQSGKLNDFLNSLSVWLEENSKFVENQDAINAADENVLLAQIQEQKLLKKMFF
DHEHNFTELQKIGIDLLKATNDCGKKKDIEADLKSISNTWNNLNKKIDERENLLLKTLQK
VQILNTCLGEIVKKLDVLEIKVNVDKDLLSCDNSDTLKEQKQHVEIMLNEVLSIESMINQ
VYLHEQDLKSFSTPTCYLKIKEKSSVVVKLYEKILNHWLTKQKCITNYEHLFNDLTNRAN
AFDQWVDDIKVQVAEFQNEIQKVIIVQKDMENHKSVLNEIKILVKELNGISQCIEPQEIY
NHIEEKYHKLITENLANLSSLQKSSLELKEFYDRVESLFEWLDKMLSDYEVKKPSYINPD
EVKEQLLAHQAISSQVSSMNHSFKNIYESAECLTSKDIERNNVQAKLDSLKLMELKLNEN
LTKRQNELMEDLLLIQKFSDLSKEFSQKLSYTETNLDAIKKEEGINLNLHKETLDTVEKN
LLQSMSDLENLKELSIQIKNGRSNIDSITIIKMIDEYDTFWKHIKLSFEKIKKSITADKT
DKEIEILWSKLEDAIEKCGIIKKKLKQWVEVPVIENLIAENILKVTEQENEINDLEDTIS
NLNKSIDLLSQEELSKSPALLIRQSKLNSLWKHIINSLTVYKGDLINSLDAAKSFWGGVK
KLKDIILDMQTKIDEQGEPTTNIDILLLMISENQNLHEVLEENCKTLIDLSNASLVLIKN
ASTENNAEVLKVLNDVTDQWDTLNKHWNLRKDSLLQLKNILISYNQDKDSIEAWLSEAEN
QNLIQGSKCCDLSDIREKLNMQRIFYKDLTKHQSEIIALNQKGSSLVEKVGEEDAEKIRE
HLALTEKRWNTLVESSNQCQVELEDTLLSLGHYHIVIEELLTWITQTRLVLLERSVPKNK
QSIEIELSKFRSVKKDVDSRRHIADSCIKIAEGFVEKCIITDRQNIEIKLNILKTAWCEM
QQLLQQKEEILNDALEETHKFYEQLQDLTAWLIEAKVILKRKIEFSDVESISVHLERHSE
FITMFLEHEENYEFVVETLTMMESNNKSVSDKFEVQKILVNLKTDWHELKDLSQSKSDFL
QNSLKNAELYQNLKHDIEIWFVQVYDAITSYGPVSTNMEVIKKQMCEVEELSSSVFEKQK
CLSRLKEVMNVMSPTYSPSEAFSLSSQIEELTQHWKEVAVKLKERKKLLASNYEQVLIFS
EGSSQLYGFLDDLEKLIDPSIGKDANSVKLQIRKNKENQKLILLKQAQLNATVKAGMFLI
SKSQCGEGPVLSKTVEALRLRWESVLDLYLDRQHRLEEALLFHGMFLEAVQALIEWLDSA
DYILTNEVAVMGDPETVKLLVDNHNSFQQELLKKFKIYESIVKTGQAMLTSGNIENAVEL
ENYLETLKDKWEAVNHMSLTKEARVKNAYELANNFQKSWIACMQNLVVLEDELKKNGPIA
DELNELKKQVDVYYLFEKNLNSHETEVNACFQKGGVILRFCHPFAQSNIHHQMTLLKKRM
SNISGWAKERKSKLTETLVILMEEETVTVELLKWISEQEAAFQENEREPLPDDFEVLSKM
LEKHFMFQKDIEAKQLVYENVVKKAKRKPLSDQQRYAMTPRSRGSDKRDFTNPKVELLCK
RWQLFWLAVIGRKNLLQGQLDEIRIRKAAAHFKWEEWRDRYNAWLRDSKSRVLDMWRKYG
NDKDNNLTREQFIQGILDQSFGAERWELVLVFDRVQRRNHVFYQDFMDALKGRKRKPDKP
VTESEQIHDIIATEVDKCVCCPKKFEMSKVGEGKYVFGEQHKLRLVRFLRSAVMVRVGGG
WENLLDFLEKNDPCRAEGRTNVELREKFVMPDNSSQSMQSFTSNYGKNIADSKESSRLNV
IKREGSYLSSNSGSIKNEKSQDSRNQSGDYVDSSSRLKKAGISSRSTSASNLSSANSSLN
LSSNSTKNAGKPTDHKVSSPGKKNSSKGLKK
Download sequence
Identical sequences gi|449676796|ref|XP_002161584.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]