SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449690950|ref|XP_002165841.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449690950|ref|XP_002165841.2|
Domain Number 1 Region: 300-370
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-19
Family GAS2 domain 0.00066
Further Details:      
 
Domain Number 2 Region: 119-277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000916
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449690950|ref|XP_002165841.2|
Sequence length 505
Comment PREDICTED: uncharacterized protein LOC100201523 [Hydra magnipapillata]
Sequence
MSSSQNSIDLNISASILNSTLKSGSNQIDENDDIPGIQIYNLWREVLSKDKMSSDIAWNR
CRRLAYDALDLFTQRIEGLENILKGDVSNFKILELDSVLEKKNELDAALFELEDLDIEMK
QVSKAFQTVAQCLPPCATRETIKETMKESRLRYFRLLNNLSHKKEIFRSLDPLLRQYKEL
HLLIICWLDDAEKRCQFFIGDYNNHDLIMENEETIENTYAELSSQKDTYENFLEAGESLC
DLIFDQPMTDIKETLSSITNRWDLLCSNLEKCLNRLEIAKELALKSKKGDIEKIENQIRC
EERRCTCHTPFQIKRFGEGKYKFGNSKIIRLVRIHGSSIVVRVGGGWEFLYEFLLKADPC
RAQQLAENSNLSTLDLSGLDLNPIDNKTNSEFTFTVRRFSLSNYSPQHRLHTRPVINGSL
DSANSSDNGCDESNDSLSFPNNNNFSTPKPRPKSFISTSLTVPLRKQSINKKISKSNENL
TRRLSLIERQIDFAEKQKKKKEKKL
Download sequence
Identical sequences XP_002165841.2.79663 gi|449690950|ref|XP_002165841.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]