SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|221116118|ref|XP_002160899.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|221116118|ref|XP_002160899.1|
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-33
Family Skp1 dimerisation domain-like 0.00001
Further Details:      
 
Domain Number 2 Region: 3-69
Classification Level Classification E-value
Superfamily POZ domain 2.62e-22
Family BTB/POZ domain 0.0000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|221116118|ref|XP_002160899.1|
Sequence length 162
Comment PREDICTED: S-phase kinase-associated protein 1-like [Hydra magnipapillata]
Sequence
MPTIRLQSSDSEVFEVDVEIAKASMTIKTMLEDLGMDDDDDEPIPLPNVNAAILRKVINW
ATHHKDDPPPPEDDENREKRTDDIDPWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTPEEEEQVRKENEWCEEK
Download sequence
Identical sequences T2MEW4
6085.XP_002160899 gi|221116118|ref|XP_002160899.1| gi|449692659|ref|XP_004213122.1| XP_002160899.1.79663 XP_004213122.1.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]