SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449662844|ref|XP_002165606.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449662844|ref|XP_002165606.2|
Domain Number 1 Region: 6830-7036
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000241
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 6565-6717,6763-6792
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000517
Family Fibronectin type III 0.0055
Further Details:      
 
Domain Number 3 Region: 6190-6315
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000578
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 4 Region: 2774-2851
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000345
Family Plastocyanin/azurin-like 0.043
Further Details:      
 
Domain Number 5 Region: 6406-6490
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000697
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 6 Region: 262-352
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000863
Family Plastocyanin/azurin-like 0.028
Further Details:      
 
Domain Number 7 Region: 799-873
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000193
Family Plastocyanin/azurin-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|449662844|ref|XP_002165606.2|
Domain Number - Region: 3626-3755
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00279
Family Fibronectin type III 0.012
Further Details:      
 
Domain Number - Region: 355-428
Classification Level Classification E-value
Superfamily Cupredoxins 0.00986
Family Plastocyanin/azurin-like 0.023
Further Details:      
 
Domain Number - Region: 705-792
Classification Level Classification E-value
Superfamily Cupredoxins 0.0222
Family Plastocyanin/azurin-like 0.034
Further Details:      
 
Domain Number - Region: 1124-1196
Classification Level Classification E-value
Superfamily Cupredoxins 0.039
Family Plastocyanin/azurin-like 0.062
Further Details:      
 
Domain Number - Region: 2995-3064
Classification Level Classification E-value
Superfamily Cupredoxins 0.0426
Family Plastocyanin/azurin-like 0.07
Further Details:      
 
Domain Number - Region: 40-148
Classification Level Classification E-value
Superfamily Cupredoxins 0.0516
Family Multidomain cupredoxins 0.046
Further Details:      
 
Domain Number - Region: 4679-4729
Classification Level Classification E-value
Superfamily PA2021-like 0.0667
Family PA2021-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449662844|ref|XP_002165606.2|
Sequence length 7048
Comment PREDICTED: uncharacterized protein LOC100202525 [Hydra magnipapillata]
Sequence
MKFNSKQEPSHSGAFFQTFNIPGIYFFETQSVIEDKAFCIVQVVEKSREHLLDIKDIGFT
HALYEVLVGDRVWVHWRQSKKSSTTAHSVLIKKICELNQVQSVDEDTVVAEDSYPARYAG
LFSYLFTNAGIYEILDGERPQLKCVLIVKPAPKQHVIKITGDEFVPALGSVIQGDRIWWT
WSGTEVEDDFFFLRLSESSSLNDATKQCCSILEHVFRNIFKSVGVFSTTVDKCGLETFTA
KNIKGTGSPQRFCCLISQPSSQHHEVKLKELGFMPKSLLIKKGDFVWWKWMGVNHPTGIE
QIGVNGEALEPSLFECPLQDKTGAFMFRFHETGTYNFRSIDFSHHLMTVVVELKEEVIKV
QVSPKSVRPDPVVARAGDIICWMWPKGVSSSITYFKPGDKEADEVLFTERRCHSQHFSQP
GVYHFTCVSLTKKDQLSEFSPEDIWSTVLVDTAETDCIVKNIDPAFFRQDTIHTIKGKDI
LFTYNKEKEDTWKWNVKQRDTDELVEAESMFIPHTGRVISFVQSGVFVVEVTSQNGKYEC
YVYVADSGEKVQAPEIVSDHNGGSVKEGHKVFLSIDLQGADVYYTTDGTMPVIGDPQTKR
YDEHNGVALESSGLKFIRAVALIKGTLPSKVLTSRRFWVKPLDWTTTDSANTSDETNQPK
THKNKKTRQKSVIKSVKNEKKDSEVEYYTLKYQEHGGVVEKNSKVVSINSNQFKPSEVSI
FEGEAITFQLMSDAKHLNNQSIYQVQQSGAAVCNGFTSGAVLQHTQTWTQEFNCSNEYFF
AFAKHPSLKVVVRPKPIIDVEVTDEGFKKPLLKLYKGDTIRWVWSDCRIYHSVTEVKYCL
KHGGYISLKNAEHSSLSGTYFQTFTKPGIFYFITEVTKPGNKIVNPGVEAYSSKATFVVQ
VLEKRKEHLLELRSNNFSLCLLEINAGERVWVQWKNKLHPDDLSNDNRPFHCVFIKRVCQ
LLEFPDVLLLDSNLKSHACILAFDFKDIGVFEICDKETSAKCVVLVKPITPQHVVRVSPQ
QFLPALGSVTEGDRIWWTWHPEEMQEDFKLSKLFEDENLDQHIETQSNTGCCLIDNEFTM
VTKNAGVYCTIMEKCGVETYRSTLTENDENTRWCCLISKPKAKHHEVKLKDTGFEPRVLY
ASKGDFVWWKWASVKEVNSISQVLLGKKYLLSLNCPSQPLYGAYFLQLNKNGTYIFKGIG
GSAQLIGSVVVHSQINLHKLQVTSKRVLPDPVVANLNDIVCWMWPKGILSSLTAYQDDNS
TETDDNDVVFSSRRCMVRALSHSGVYHFSCSSLPNKVKEDSDFAPPGIWSSILCDNTEEN
YIVNFTDQKSNMSVYIEKGENVLLSLSANRELKWTISDSNQQMVSLESILLPEVGTLFHF
NQTGCFRITADADVPVKNNLICNAHVWDTMESSPCILSGEMNGGSVEVGHVVYLHCASDA
TIYYTTDGTMPMAPFSMLYNKDEGVQLLNGGIFFVRARAYSDGKRPSGVFTSERFYVFPP
ETPEPYFADTEVSYKSNTDDVIAAIEGTSLVLQTKSGQNADDIIGDNQIVNQLEVQIKNS
AENDPPTKSEENNLPVKSIEDNLPIKSVENNLPIENVNNNLTTKIMQNCLPIYSITTAPL
KSHEKFVNGEMCIEESINEKEQRDGADSENVQSWKVQRNDLNDKRNSFLKNDYESLKASL
IEDITEGLLPTEIEKLQSQVEESSLNDINESTEPSATNSDFGNMQSWKIRRKDLEETRKS
FLKDDYEFIKMSLVEDLTAGLLPTEKEKLRLHIEENLKNEILESEQQNCFSENKNENTED
KNKDPFVQMQYWKMQRIDLNAKRNNFLTHDYELLKMCLIEDLTEVDEVKKTENKERINII
EKIKIWKKQRLDLEEKRTCFLNDDYESLKKSLIEDLTEGLLPDEKEKLRLHIEENIFVPE
QIVQDSVVGESIQIETIEDKNKEYNINDEVKESSIEILNILGNQKDSNPYITDDWAKEAC
NRDNVVQDHSYATEKILEANLVLVEEKTESFMAEKDDDLAQSFIEERISSMRPRSNYRSD
SRIEDVILGNVDVGLETLFSANQQDVIEIVKEEKASIINRITREDSIIIKVEDTFKELKS
QSEVADKELELSGDKNVTEYIEHTDKENMSNVNQGHNRQDHDDKTENVEIIIKEKLVSST
NEINNDSSFQSKSIEYHSSGLPLFQSTPVQSRDDQLDYDAMKHESLSDVKPINLDNHFDS
NFIDKDNTMLTSNYISVKQVEPTDNKEDLAELLSFCEEVNLSITDRKHAQQITFSRKDTE
IKVRNIVDSMFDSGIAEKTFSDATINNDQDHTLTTKYVGETDKSEQENVCHSISEDQNDT
KVCNQVSRDDLQKTVVEPESILNSEESNSQHSGSKKQSSIHSDARQSDVEAHEILPENMN
AANANFKLNFASLNSIRFDTEDSPESQQQIFSDSNQNASLNASTLRSMPVGSDSEILPKD
TSCSGNTSDDEISLRSPVNDIKEVNNPNVCKTSTSAADMTLGSHTDSNSVNDSDAGLIPY
QRITPNSLSASNRLNYLQTAMEGMFDDELSYVENSFSEMNGIIHFKRLPPNELKSSLKNT
ESQKESYLPLGYHDQQFKKYNLLQSDVSDVSESLKGFNVNGSEHIEEVDIGPLKRLQSVE
RLSTNTANSLKNDLDLKPSTSPAYTVDKKFKEGFKMKISGQFVTVTDTKFLPDRLVIFEG
EAITFQFSNNLLTSDQIYQVYRSEEAVVRVDGGFSSDNSLQQLKTWTQEFNLAREYLFKF
RNHSPVKITVKSKPVIDIKVTDDGFSVAVIKLYRGDTLRWSWKNCEEPHNVMERKYCMDH
GGYTSLENQENARYTGTYFRTFDTAGVYFFATQSYDESRAFCIVQVLEKSREHLVDIKNS
GFTRKILEVTSGDRVWIHWRPTLGSVSEGDRIWWVWREVEVSENFLLCRVKDGSDHGERN
HECCQRSEKIFISVLRAVGVYSIVLNTYGLQTFKASQENGEYCCSLIIQPMIKIHEVRVH
DTGFGESLLQISKGDIVWWRWNNTKLVCKVRSCGININNIVQCPEQYYTGSFFYQFNEPQ
TYEFEIVGPEKSFKISIVVKPGIQVKKVHVTSKRVVPDPIIISLNDVVCWMWPKGSTKNE
VCDIWSTVLVDTPVHDYICTVDCNRKNHKQDVIHIEQKKKIMFTYNMDIPDTWIWTVTRF
SNKQKVEIDNHFIQKCGRAFLFNEIDTYLVVVESVNTIYECIVYVHGEGEIVDPPSLIMS
VSECEKLTVGQKIFLTHPNNEAKLYYTMDGSFPHPGSTATREFDSIEGITLVDSGIVFVR
AVALVTNKKPSEVFTSRRLVVVGNNIPLTSVATSENETNLGNSKSKQLLSEYLEHEEAAV
KGATIKDVFEESNGDLKVITDEQNLNRFNEDASSSFSKIEDRSIESHNDPLHILKGDEKD
GTGYNTNEIQNATTGSSESTSNIVLVDRNKEKQINEPFNADYEKYVITQDNFLHSKLSNF
NDDVDPSQNSFSEGSTITQDFKETPQINFIKAGPPSTTSEELLTSEHFKDDASVNSDHTL
VAFDEPKSIFNESSAISDVGKEIYIVSDNEVHTLVMDAKEDGIKINNVQAVTEVDAFKLL
QIVPNDDTGIKKHEDLVKLEMCIPRITASFLNSNTVNIILIKNDKNDLALVKGYFLYVDG
MPRGSILESCIQALSVSGLRGGRSYEISVMTFFTNQDIEPLISNILFITCPSVSREGGPV
ISLSSMDNRGQVKVMWMANYHPDKTVQNYTLKVNNEVVKTNILPVNSVEEYCICCLKDIP
ENTLIKVSVLASLNEDLVELSSNEIFFSLPFSLCFQSYSLNQDQDYQGNNNQGNNNLFIT
DSNSDVQENIDKNQLTNLSVSCHLLASESIDLSNVDDILQVKESKVLLPRVLQDKLLHVS
KKSLLDNIPENVDENILDLADQMSSDKTVAVASILKNPESEINDSGDGTSKGETDNQFNE
CEASNSVDCVDNFNANEVDVSEKDDVIVLTDKSFKDFNNNNTALVYGNEEKEIVRSQEGT
PDEFLNDDYFNYKTYLLQLSDTSKQIILDLIESSLDIFKKNLMLSDNFSGSADQEEKEDR
GEFHENLDEVDASATLNVTQKEKNLIEEINVNNAKIKDDYNDLDSPPATPAESECEAPLW
SKKIKAEMTLKRTLFEEQFKREKQNQMERELWKKGLEEEIELERLALMLTQQTLFQVKSE
EIEKAMEKKIFELTEVSRIAVEKVEAEKVRIAAEEAEKLRIAEEEAEKLRLAEEEAKKVR
IAAEEAEKLRLAEEEAEKVRIAEEKAENLRIATEEAEKLRIAAEEAEKLRLAEEEAKKVR
IAAEKAEKLRLAEEEAEKVRIAAEEAEKLRLAEEAEKVCIAEEETENLRIATEVEKVRIA
AEEAEKLRIAAEAEKLRLAEEEAEKVRIAEEEAEKVRIAEEEAEKLRLAEEEAEKVRIAE
EEAEKVRIAAEEAEKLRLAEEEAEKVRIAAEEAENLRIATEEAEKLRIATEEAEKLRIAA
EEAEKLRLAEEEAEKVHIAAEEAEKLRIAAEEAEKLRLAKKEAEKVRIAEEEAEKLRLTE
EEAEKVRIAAEEAEKLRIAAEEVEKVHIAEEEAEKLRLAEEAEKLRIAAEEAEKLRLAEE
AEKVCIAEEETENLRIATEVEKVRIAEEEAEKLRIAAEEAEKLRLAEEEAEKVLIAEKTE
KVCIAEEEAENLRIATKEDEKLGIATEEAEKVRIAEEEADKLPFADEEAKKVRIAAEAEK
SQIVAEETEKSYVTVEEAEIKCIVTEVIEQACIAAKVSENINITVKVTDKPCFKAEAEKL
CIAADKAEIECIAAKEVEKARIAAEEAIITCLAIDESNKICDGVEKLSPSIEIDENMNIA
AKEAENLHSAEEEAKKFCIATEEAGKVHIAAEDAEKLTFDAEDEKQSIGAEEAENLQAEK
LRIAAEEAEKQRIAAKEDEKIHIAKEAENFCIAAEEAEKVRIAEEAEKARIAEKEVEKSQ
IATEKAEILRIATEEAEKLRIKEEEAEKVRIAEEEAEKSHIATEEAEKLHISEETEKMRI
AAEEAEKSLIAEEEAEKVHIVEEDAEKAHIAAEETEILRIAAEEAEKVRIAEEEAEKSRI
ATEEAEKLHISEKIEKMCIAAEEAEKSLIAEEEAEKVHIAEEDAEKAYIAAEEAEILRFA
AEEAEKVRIAEEEAEKLRIAAEEAEKLHISEETEKMSSAAEEAEKSHIAEKEAEKVRIAE
KEAEKAHIATEEAEILRFAAEETENLCIAAVEAENVRIAEEAEKSSILAEEAANVRIAEE
AEKMCVAAEVAESLCIAAEAEIVHTDAEKVEKPYIKAEEAEEGRIEVEKTKDTHNEGGKK
TFCKAEKTMKILNEEEKSCIETEDAEKQYIKAEEDEKACIEDKKTQTEADAAEKPHIKAK
KPENAYIEADKAEKIHNKAEKERIQIEITENASIEKDNVEIKAEVEKEHIEAEEFKKACD
NCEVAEETHIETEKALNFNVCSQDKHFSEEDYTKISNNLVSSIIAESEKELELVEVVYIL
CCAAIKDAESDVINEHENLLASDSFMAVDKDFKKEVNKNTVDLSINNLCSDCHPDLETKI
ENNSIENVNSSVNTFCAVDCYMPIKYIVNEISRKNDVDDIPHTDSLSRFDDITFKNDIEE
IAFNNSDVSSVINLKKDNNFEKDQSKLTEPSETFQFEDKKISLDIKDVKNEYLYTEDIKN
KSFDTVDVKNEFLDTEDIKNESLNTEDIKNESFDTKDIKNESFENEDIKNQSNFCIEEDN
SPDNSFKLLASCHDNLLNFTNNSPSRTLMTQSPAVLMMQSPAILQFEDINHNEELPPEFE
KARKDHEIKVRIEEARLKQEREDLLLKQEALKNERLKLEIEAEEVQLKRFQYFKNEEEND
YRQKVEEKHQVAERLRLEEVRKKEWIESQKKEIENAKSDYAVKIVSDIVMKDITKNLVEC
TIDEACEEILDKAQSLKEVEDAQSETDDSVQGFEQEFIKDLNKPSCKYFMKTVPLNSSSF
VQGNQFSKTEDNILFTVKKNQNLKKDDVDFSDEIMKSSFDISFDDEIHLTPGKNVSAQTV
NKTNRLPQGLDISVQSTENNVLRLQWDWKPSIMNSGFKIWYSVLVLGTKFSQNVNSHKSH
KFENSPLPEAWPMTNRDKMKEVCVQHCWDTYSKLMDLKGLKPRYTYRICVLGRRDRSGQR
LTFGHIQLTMPGAPSRPDLKVKHLGDKEVVLTWDEVTSYGEAFLSGYQLYMNGEVYGKVF
PPETLKASVKNLVPGSQTVFTLVALTNHSIGNSRPSRAVRVSCPLEPPSVQEIFQVETDQ
IGVVLLTWQVPTYNKSFTSDTKESDTQQNEKKDEPVISCYLIVVDGKLFGKCSPDANDRD
YIGFEIDGCKIGQEYVISVHSYFEPLSINPNQRNVVCGCSSAPLNMVKCAPVSPPKSPKP
LIKSISIEGIEIAWEKAREFGSAKLSGYIILVNKQVYGPIIPANSLSTILNDITPGHDYH
INLVATTEHLVGRQKNFDKKNSLYINDSSSSENSFNAKESGDSGFFNFISTVQSMRDSDI
QLDNYSACVPGPTLLVRFNNFVVSPEKVSVLEVTGQSVQLAWNFSLPKYSKNVLEAILVR
PEVFSVQYWLHGASMSSSKCKETKGTRMFISELQPGTDYDVAVLSKARHQNQCDAWDPHD
PYLCKEISTIVTFRTGHPPLPPTEFSVIGGTTRSIKLAWNEPILRGVKVTKYLLIITGPV
CNPFTASSDSLSSIPKFIERKLKTKKTVITNSSINDVIPRVCEISPDTVIYEVKNLSEKT
EYVFSLLMVTPHSNVNMLKELYDTVHEKEPFVNDIWTPSITTSGFTAAINPPENLCVANR
SANSIHLTWKPAKAYGMYVLLYNMVCWSEVEVEEQEYLSSREKIPLVREPQVGKLYISST
LSETTVDNLIPGSKIQFQIESCFGTAQDSPISEIFQTNIVTTWTRAPPAVPKLLVTNISQ
EEFELSWNRPVLLDLDTSRPINKDASCILRRTLIGYKLEINFGEYVVLSPSATSYIYKNP
KPGQTYNFMLTAVTCALQTTKENRSNVI
Download sequence
Identical sequences gi|449662844|ref|XP_002165606.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]