SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449663246|ref|XP_002168040.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449663246|ref|XP_002168040.2|
Domain Number 1 Region: 418-609
Classification Level Classification E-value
Superfamily Fibronectin type III 6.96e-33
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 617-775
Classification Level Classification E-value
Superfamily Fibronectin type III 2.36e-25
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 989-1170
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-24
Family Fibronectin type III 0.00048
Further Details:      
 
Domain Number 4 Region: 782-967
Classification Level Classification E-value
Superfamily Fibronectin type III 3.56e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 5 Region: 1274-1357
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000000103
Family Double-stranded RNA-binding domain (dsRBD) 0.012
Further Details:      
 
Domain Number 6 Region: 228-320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000295
Family I set domains 0.045
Further Details:      
 
Domain Number 7 Region: 21-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000158
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 1463-1542
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000595
Family Double-stranded RNA-binding domain (dsRBD) 0.014
Further Details:      
 
Domain Number 9 Region: 1371-1444
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000000152
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 
Domain Number 10 Region: 114-201
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000027
Family I set domains 0.011
Further Details:      
 
Domain Number 11 Region: 317-389
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000105
Family I set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449663246|ref|XP_002168040.2|
Sequence length 1809
Comment PREDICTED: uncharacterized protein LOC100200359 [Hydra magnipapillata]
Sequence
MLRMLLLILFLLYSCQIGLSYTPPVLLEEPEDTFGYDKKPLTLKCRSSSSPPPRYLWFKD
NNEVSNTRYTITSVGDLVISPFVATEDVGIYRCMVKVDVAINNAELKLVSRNAKVQIEEF
PQIFASDISATTGYVNGALRLSVNVSNFNPKPKIGWNYRGKPSVQDNDPRFTVLSQGVLQ
ISGLLSSDDGEIRAIAISKSNSNTMFGKFSKVTVEEASLRPQNKLFYFLGTPQNIELEWG
HSTILEAFADSSTSVLYTWFKDGKKVILSDRLSIVGKGNLKIQFAKDEDTGLYKVIAESA
GQQIEAIAQVKVISPVQIILSPPPQITAMEETQVKVNFSVSGNSPINWFHDGVLVDTSSA
DYLQFGTNYVIINNIINSDAGMYQGRIGNTNLHISFELIVIPKDSIPTQDTVNSLLIPGK
PLDVIAKARSATEIDLEWKEPAVPNGVITSYGIIYYDSPSTASKITVTDPTQRFITVKNL
TPGTTYQFRLQAFNNKGPSLLTDAVGARTLDLSSLPGVVENLKVVPSKSSMIVSWDSPKS
GAGSSGTGAGVRSYAVFYTPQGFSGNPFKKVGSGTTLQVDDLTPGASYRVWVVSYNNDIA
GPKSQELIVDIPFASEAPQPVINLVVTPALTTVANVNWEPPQRNLQPNTLYDFYVVAYNG
AVAGLKSSIKKVKMLEEVPPAPSTLKIVSIGNDTLKVRWSPIDLKSFQGNLLSYELQYFE
GDLRHTAKAISNIPKSSKEWKITKLSPQTVYNINVIGVSGNGRGSPSPTINVKTRELTSE
GPSEPADIKLTHDPDVPDVLMITWDEPLYVSGDVKSYIIYYRAHPSDNYISKTTIGTAKG
FNITDVLLGKLYESYMVAVDNNGQGKKSSVFERMTMIEDVLPEPVSKLSVDPKADSLFVS
WEPPVSSFNVIVRGYKINIFSAKTNAEIFQDTLIGRQNTHLLLYNGIEPNERYTVNVQAF
NKFGKSDIVKKDATTLQASKSTILITDVTKSSSTIFFKWIDTGIVSGVGNYIVRYDVYDI
NGIPETKNLAVFKNEALITDLVAFTNYNFYVQHATETTFPKDITVSARTLEAVPSAPLDL
TAQGIAEYPSWLILSWQVPRYPNGKIKEYVILYSADESLDYKEWPKIETKSISMTYNITQ
LTTNTNYFFVVYAINGAGEGSKSAVYSKKTVGGGVVPITVIGAAASRDSGGWWWWWWIIL
AIILKKLYIATPVLTQTTNEKINGHIVNESKDVNVELTPLTSAVDGEIYGGDGGLGTNKS
RMASSSLNSSRISLGNVKVPVPSDASFISYKTSLQDYCQNTGWILPVYTTSLGNTGWTSK
VSFGKIHTYESAECGTSKQDAEQRAAHAGLIGLGVLDFRSKYSDDTCIAVPGQGDGSFIS
YKCSLHDFCQQCSIQPPKFVTSIYENGYSSSVKVGQHTFNTVGRSSTSQEAEQKVAFVAL
QGLCMVDSQAVYDPLVCYTVPGPGDISFISFKSNLHDFCQRFVLPPPQYITNQGQQGFSA
KLKFGGLFFQSNDFFQTRLEAEQHAAFEALQGLGLLESTVTFDSAWESSTILRGNNMKHG
SGIITLGNVGGSLPRSYSHQSSKHSRSGSISTSRQGSASDLKTSLNIPTDFVAAEITRLP
PAPNIQSNQNVSFSMGPRTYSSGSGFDRTTLNDRVGSYSALGRIPSNNNILNYNTSISSG
FPKGLSASQTHISHSTPYKEYNGGDALLRFDTDFKDSPKVNYISQQHTKKEVYRTGSAYS
SSSMTVESSSTSQFSGPRNYPGSVRDVTYIETPRTVRTASHPALGDLENEMAGLEGLIKD
LNGIASKPL
Download sequence
Identical sequences gi|449663246|ref|XP_002168040.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]