SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449665906|ref|XP_002154464.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449665906|ref|XP_002154464.2|
Domain Number 1 Region: 615-749,808-863
Classification Level Classification E-value
Superfamily Fibronectin type III 2.79e-35
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 863-1031
Classification Level Classification E-value
Superfamily Fibronectin type III 4.79e-26
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 495-617
Classification Level Classification E-value
Superfamily Fibronectin type III 6.81e-20
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449665906|ref|XP_002154464.2|
Sequence length 1114
Comment PREDICTED: uncharacterized protein LOC100205987 [Hydra magnipapillata]
Sequence
MANKMLVLHFDGKILKHIEEDTRQATTADRLSVSVTSPEFETKDDLLLGVVPTDSGNGID
MAISIMNLLEYFEICDYIVGFCPDTTVSNTGWKSGAITIMARFLGKPFLWLLRRHHIAEI
NITWTLKAVSMEMSKAPANKLLKDFQQKWITEFFPKVSASGAVEKFKRFPEQDLIVRSDL
CKLYLKSKKFVTKALEHEIFPRNDYRHLVEYLAYYMNVKSEKLNNFHIYQPGACHNARFM
AYAIYFQMLDMTSTVVEYLTSEKKHMVSRVAFIVAIYYGPAFLNSGKAEHAVLNDFNAFK
IAETIKTEWDYEVGNSLQKSMSNHTWYLSPKVVVLSLGDPYMKADAKRLLIQKLLKFPIP
ELSEISVTAPSAVNITSDSRLEDLITKESWLFFILTGHTESVREWHTSSDFLALDSYKNF
AQLVCNLSVTNDCAERNISLIKNFVHSSHNEDQRQNILLVVREHRKLITKDMSLKELFFP
AMINIMKLANGQSFVKVYHGPDNEFVINNLQPGRTYQVKVASESKVGIGTFSPVANFTTL
AVCPKNVNPPRLSLAPEMNVLHLEWESDIVYNGVKQGCSVGDLEPGKEYFFSVQATNSAG
SSQWSSVVGFKTAPGPPEAIHPPNISFKSPTHIFFDWMEPTLHGAPITMYSLEKLENELF
QKVFHGTTSFCDLKQGVQPATTYYFRLQAHSAAGNSPYSSIFTVKTPPAPPGLVQDIKIL
EQTSNSCFIEWPHPQDNGSQIIEYILEATGTTSMLYTIPRTICVEDSMLDILPVSEKANE
VKQEKLDSSDDEYSSSDEEEVLHNSISGSESSVTLRQNDNVMEYRLTGLEPDTLYKLRIQ
AVSEVGIGAFSQYVQFYTKELPPLAPTLSASSISYHSIKLKWGHQSSKKSILNHTLQMQN
KSGSFNTVYSGMDTSFTLSKLKELTPYCFRIQSSNEAGEGQFSMPKVFYTKAQPPSHVKE
LICQHVDISSIKLIWTPVESIRPDDITKYTLQMQNVELGNNFNQVYNGIKTEFTVCDLEP
DKAYQFRIYVTRTLSAMDRNILANVPEDIKSIHSPIIRVHTLRQAISKECEHDLKKIEPA
QAIGLTDTHIALIFLVSFLAICVVTIVLMYIATN
Download sequence
Identical sequences gi|449665906|ref|XP_002154464.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]