SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449671152|ref|XP_002165655.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449671152|ref|XP_002165655.2|
Domain Number 1 Region: 269-445
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000287
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 796-848,900-923
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000204
Family Thioltransferase 0.057
Further Details:      
 
Domain Number 3 Region: 83-231
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000896
Family Fibronectin type III 0.0062
Further Details:      
 
Weak hits

Sequence:  gi|449671152|ref|XP_002165655.2|
Domain Number - Region: 464-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00073
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449671152|ref|XP_002165655.2|
Sequence length 1074
Comment PREDICTED: uncharacterized protein LOC100214450, partial [Hydra magnipapillata]
Sequence
WQELIAVFHTPTHSKDSIDCSLEDIDASSSEVVSVNTPLTHDFIQFDWLSCKYSKVGSSQ
LKLQSNNENVNYPGAIVVRYKISGKAFNVDSLKIIWSSKSDEFFTDELEYDSRGYEIYFP
KPKSVYCIRVEAIAEEGGSPITISSPYVYCQVPGPPDPPFITCHNISKQGFDIDWNEPQT
YGGNEVGGYSVVVNGMKMGKVLPSMCRSCTIPCKPGRTYKVYVVALSSDPSYTSSEKSNE
LIVNTMSENDEKNLTKKIEEVMPLADILLEVVSLYENAVEIAWEDPVLDNISMLDHFNIQ
WTTSHSKINSANLDASHHDYYISNMSAGETVFITVSACSKTGALIAKSRQLETQTVANIE
TPVLRVGSCSGAMLNIEWKTPKVYGDALIEKYVLRLDSVDYDADVNKDANTYQFISCEPC
CTYSFQLQAISTKTGYSSEFSKELFVTCPGAIEPELCRIKTPVVNCIKVCWKAPELKGNA
QVANFWVYYSPAQSGVFQVTASEVINHPGAIAHGPLSNKVYEDSLTGINPCDMYNVVLQV
DLLPADCSSVFSSPLRTKAASPPNPPAISAQILGMEERIFLEELLQKLISVRDRLCREVN
SLRSTVIIKHVADRDYELTRLFHILSKIDVRIKQIMKEIKTYTGQVKVLLSWNFPGHDED
ATASGFQVLIDNKQYGPDLSVHTNSAVVELPCDTKVHMISVITTTQHPVGSSGYSNTVSI
NSDEFLPFSFFCYFESHIKGAGYSQSSCCSYENTLNLDSSRKYDKPGKAIPYRGFIKNGV
AAPLVQGVEIRSLEWKPLVEKSGKPTFVLFWTNWCRPSVRLLHLLTKYADENPYNFAFVT
CCTHSGESSKSHLSKLQEIYNENGWSDMSSVRHLCTCEQNVDSLLVRRSISGNTLSLPTT
AELFNIVGVPSIVVLDAKGYVSWQGRICALNYQYFGNFVSHVWSQVVHQPCEVRDCCLCT
AESRQERYLVDEDLMNDLVDTLPHSKSKATKKSVSGLSQANRGRKNLKTKPPKFHNPYEE
ESIHELFTRSRKAKRSNSIFPLIESDRNLIRIEPPKKITPSSEINTLRSLASIS
Download sequence
Identical sequences gi|449671152|ref|XP_002165655.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]