SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449672830|ref|XP_002159674.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449672830|ref|XP_002159674.2|
Domain Number 1 Region: 1113-1306
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-23
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 2 Region: 391-575
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-22
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 88-231
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-18
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 4 Region: 1441-1536
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.33e-18
Family Voltage-gated potassium channels 0.0026
Further Details:      
 
Domain Number 5 Region: 847-905
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 6 Region: 792-840
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000275
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 7 Region: 1009-1114
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000016
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 8 Region: 587-639
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 9 Region: 316-389
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000635
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 10 Region: 743-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449672830|ref|XP_002159674.2|
Sequence length 1571
Comment PREDICTED: uncharacterized protein LOC100199700, partial [Hydra magnipapillata]
Sequence
MIPFIESFHVSGSANASFITKNVLPNYFRGNNIYWLFNINVTDKNYNPGPPPDEYLRKPI
YLINYLDKYSGHSDQCNWDNIKKYFNQKIDFILDLVGLHPYTQYEVSIQLCNKLGCGNLS
NSVTIQTYSDVPSCEPTLLQMQNLSSTSMNISWNGLNLSCANIDLKQISYTLICHRSQGS
LLINELINVTTILLTSLNKYEQLCCEVAASNINGTGPHSSQSCAFTNEDTPDNAPKYFTA
FFNKTVIQFNWECLQNTIDAWGDYKTPGFYQLSYASITAFSIAAGPESVTCIQNNLTDKN
YNPGLPFNEYLYAPVYLNYSLEKYSISSDQCALDDLVKYFNQKTDFVLDLVGLHPYTQYE
VSIQPCNELGCGNMSTSVTIQTYSDVPSCEPTLLQMQNLSSTSMNVSWSKLNSSCANINL
KQIIYILKCNRSKGSMLITKNINDTTVLLSSLNKNEQLCCKVAASNVNGTGPYSPQSCAF
TDEDLPDTPPNIFNSTDSYTTITVKWLPVSTENSYGTITSYEICRKQLYKNNTVGTNYCI
KQINGLILEFNFTNLDVASTHNISVAACNKIGCGKQIFIVASSRQLMNANWSAWSIWSEC
SQSCNGGMRIRSRQCIKAIDRAPCIGSNLDNETCQLQRCSSFVLGQAGVTDCNSICEAKQ
LLCSNNFPKFYNDTSIFLDASPPIICSNTSTFSVYSSSRDPSFNSDGTCLGYVNLPTYFP
CKSDSEFMQQKMHRLCYCISKGDIGFSEWFEWSFCSETCGESSVMIRTRICNGNCSGVSF
QKKQCDVPVCPVNGGWSDWGPYSSCNASCGYGVFIRTRACNNPPQLGGGTPCYGPQIDIR
PECGAFPCPIDGGFSEWTEWSICDKPCGNGTSKRVRHCNNPVPAINGKECSGNFTITRDC
LMTPCIAVEVNLVQRTLEKWTWKMYSVMSYESQNFTIYFKDSVRALFVQQGLKGLTDIFV
NKLVMGSVVVNYTLRFEYLYGQIVDYLDIINSTGKLINILVTSTQYSSNDVPCPPPYNIN
ASVYNKFNVRISWSRDSCSNNEVWLYLYYKDVTNSSSIWEWKGVPSGSQSLILSGLAPFH
VYNAYLLTASSNGNGLPSRVFVLQTYGASPERPPANVSTTALSSTEIYVEWTDTLEQYSN
GKILGYKIRYKVYLSSDPLKEVDAQYGFNAFILKALKPFTLYYVDVYGYNLFGAGSPIYS
MCKTLEDAPSVPVPNIQVNDMQSSDWWSILWDSIPTENVNGILLGYRLTYYMSYRSGEEI
FGERLKYTIVFDPFTRYHKQTNLLNYAIYNFSIVGFTSAGSSPAYEYQARTCKCKEVLFA
NSFIKDPFVFLDANKASGDFVDLLKDMVVQSCGTCNGYSSKFSKLYFDRTKFGGNPVKNS
EFDLKLSISNDIDISFPIYGRNGYEVATNTSFMLLIQSPGIAAVQRDESNADVIFLKMIL
NVLSVWSFLLITCLIASLFGILVWFTDQFINPEQFIIGNAWKGPIIGFWFSFVTMTTIGY
GDLTPRSLMAKLISIIWFIIGLALNSIIIGFIVTNITSITLPPDFIMYDTEVAALQNSFE
HKAAVRRNAKL
Download sequence
Identical sequences gi|449672830|ref|XP_002159674.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]