SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449676743|ref|XP_002160617.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449676743|ref|XP_002160617.2|
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000641
Family Domains B1 and B5 of PheRS-beta, PheT 0.0073
Further Details:      
 
Domain Number 2 Region: 215-258
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000139
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449676743|ref|XP_002160617.2|
Sequence length 282
Comment PREDICTED: phenylalanine--tRNA ligase beta subunit-like, partial [Hydra magnipapillata]
Sequence
MPTVSFRRDLLFEALGQEYTEEEFDELCFEYGLELDGVTSEKMMVSKEKGEAKAGEASEE
IIYKIDVPANRYDLLCLEGLTRNMLVFQQKMKIPHYKTVVPIRPQQLIIDKAVEKIRPFA
VGAVLRNITFTQASYNSFIDLQEKLHHNICRKRTLVSMGTHDLDKIEGPFTYTAKPPNEI
VFRALNQPKETSAIELMELYKSDNQLKHFLHIIEKEPLYPVIYDKNGIVLSMPPIINSHH
SKITLDTKNVFIEITATDEHKAKIVLDILTTSFSCYCKDKFS
Download sequence
Identical sequences gi|449676743|ref|XP_002160617.2| XP_002160617.2.79663 XP_012558404.1.79663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]