SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449678673|ref|XP_004209137.1| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449678673|ref|XP_004209137.1|
Domain Number 1 Region: 740-919
Classification Level Classification E-value
Superfamily Fibronectin type III 2.44e-37
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 554-734
Classification Level Classification E-value
Superfamily Fibronectin type III 6.62e-34
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 3 Region: 918-1091
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-31
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 1305-1474
Classification Level Classification E-value
Superfamily Fibronectin type III 9.13e-26
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 5 Region: 71-120,416-550
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-25
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 6 Region: 1114-1297
Classification Level Classification E-value
Superfamily Fibronectin type III 4.95e-22
Family Fibronectin type III 0.0053
Further Details:      
 
Domain Number 7 Region: 1482-1664
Classification Level Classification E-value
Superfamily Fibronectin type III 1.1e-20
Family Fibronectin type III 0.0068
Further Details:      
 
Domain Number 8 Region: 1752-1926
Classification Level Classification E-value
Superfamily Fibronectin type III 3.35e-17
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 9 Region: 1696-1747
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000277
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|449678673|ref|XP_004209137.1|
Sequence length 2127
Comment PREDICTED: usherin-like [Hydra magnipapillata]
Sequence
MHKEDGNERPDKTVTKPTIEEVHKTIDTLVNFSIFIQNGKIERVALNASKLFEKELCELL
KQTSNPDFFLPSGMETPSVKSLSSTSIQINWKPPLNVNGVLIGYKVFRRAFLTCSGLLAT
PKKCLYIECKINEAICGASCYDPQHNVCCNQLVYKKDSQKVCCNNHYAIKNTTSDICCGD
SLYPFQVDYQCCYGYYTHVPDGYVCCSGNNGIIVGIGDSCCSDVPYSINGTKVCVCGNLY
DRQPTAIKCCGGKTISMQDVCCGDEIQGVGYGFDPSKMCCGTKYLVSQNTLCCTNSFGEV
QAYIFNSSASFDQHKCCGTTYINSTELCCNYVGYNNVTDICANLSTYGVTGCGNGTSCLR
SNKMSLCDNCNFNKSNYSCYITIPDYDPIISSFQSNLCPSDFTEILNNSQNASILTFIDN
HLMPHTKYEYYIVVFNDAGNASSALNMSITEMGQPENLEAPVPTVLSSDKIFVIWSLPNK
PNGQISEYILYRLKWSTKEERLVYRGLQLSFLDMDGLEPYTGYLYILSACTVSCTNISAS
VLAYTEEAIPVGVQAPLLQAISSNSIQVNWSTPTYPNGKIIFYNVTILIKDIYRSLIPND
SIGEMMSLTVSGLLPYNSYTFKVYACTSKGCSSSPSASATTLQAAPESILPPQITIINAR
MVELEWSPPKSPNGIILSYVLKRNLTVIYNGMQLNLSDVSVLPATLYIYTVGASTLGGYT
ESNITVVRTPESTPQGIALPNLYALSSSSINVSWSMPALSNGILISYTVYYQESDSLIFK
KPASLNFSVLITQLKTFTLYFVRIEACTIVGCGSSDKASVRTLEEPPVGQQSPTLFARGT
TIVEISWVQPLFPNGIILNYQVERRSSMVSYIIYVGLRTDYIDTQLTAYTEYEYRVRSVN
SKGESISEWSKVRTFEGVPENVQPPFIEVLNSSSIFAKWDPPTTINGILIEYSLQIRLFS
QPQLIEDIRCCIKPSVTKVQVDGLLPFTSYEFRVVASTFIGSSYSPWVLVRLPEALPSGI
PDLIIRPLNDTTSLEVLWDEPTSGNGIITNYVVFVDTIKVYEGISRRTILRKVLSFTNYT
FQLKVCNSVGCVFGLEQIYTTGDIKLNSIPKPGILFINASVILLSWIPLDRFNISSYQVI
RESLSLLRNKRSVSEIIICSLNITSQSTTTTFQCTDTSVKPYQKYRYRIYGYNDQTIIES
DWVEVTTAESVPEYVLKPNLTALVGPSVYIQWFVPPIPNGLIHHYEVVRNGSFIISTFML
SYIDINILLPNMQYEYKVKACTNVGCTLSPPSNITTLSLIAGIILPPFLTVISSSIIKAE
WLTPNNLSIDIAKYRLFMNKQFTPIFEGYAFVFTVVDLKPFTRYLFNIAACSYINCFISI
TVDAFTKEAPPEYLRAPFFDVLGTHFIEVRWTAPSKPNGIILFYILKRDNLVLYNGTGLN
YIDYNIYPASIYSYKVIAFNSVGWVESKLAFVKTSEETFSAPLLQAISSNEVNVTWLPWL
PPNGSSLLITSYKIMYADIEFNVGMVFQYLAKNLTPYTKYDFQIKACFKSVTDTQSGGCV
TSATATITTLEASPENLRAPYFFSEEIRSNSIIVRWDYPLIPNGEIMFCELFRKRNDIIQ
LYKGLSTLYLDNSSSVVPNTRYEYKVSCNNSIGGISSLWSAVSTISADDTILLIVTNKTA
TSFAYEIILTSQLINFKFNITTTNQQGNVSDLKPYTEYTVRVYGCNEVGCLVGKFITFQT
DSAAPQGFDFPPELVSMTSREIEIKWSVPKYPNGIIIQYNVLLYHPCPQLSNQINCVVES
NIFSSGILQTYKLKYLTPFTEYEIKVIALNSMGSTSSQVLKVTTESEVPVVLQQPLVYLA
SNDQSTIIVSWANVFDLRSRLIGYFVTENNLLAYSGTSATNLTRPNRPPAYYSYVVTAET
FVNNTPVKISTSSVGVLVGNIPTVVPTTITTTGAITPSAGLQSNKIMWYQTVWFLALCAF
VFVLFVFVIIVCCCRGYRKNKSVYVRERQPLPMKFKYKSRASSLNEFMSPECRRQSGFER
CSDVPMSRNSTPRRGYFKEINSERNNNYCDDDLIWHMEGSRRDLDSGLYDDFDPVNFENE
FEEQPIRDRTFTTNRQSERFILPDTRL
Download sequence
Identical sequences gi|449678673|ref|XP_004209137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]