SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449680276|ref|XP_002170657.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449680276|ref|XP_002170657.2|
Domain Number 1 Region: 1351-1468
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000183
Family Calponin-homology domain, CH-domain 0.0053
Further Details:      
 
Domain Number 2 Region: 213-322
Classification Level Classification E-value
Superfamily PapD-like 0.0000314
Family MSP-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449680276|ref|XP_002170657.2|
Sequence length 2716
Comment PREDICTED: uncharacterized protein LOC100210504, partial [Hydra magnipapillata]
Sequence
MKGTRHAKKLVKIMADIIIQILGIQINMLFFYRVELESQTNHHVLIIKANIVLRSLQLLS
YDNKIIDCLRFGYVYYGTDVVQTLWLYNNSPQESKFVAVIGSCDGEEMGVDITKKTICSF
VDDFGENWRHEKSAFFSVSPCEGKLDPFQKTKLYFKFSPKYMQPLKGWKSIMRIPSREDF
AMFIRISSVGVLQNPMENLNVELAMTGTALPVSLSIFPSQFINFDKCFIGNTSKVVITLN
NNSPHLSANFSIKSSAHFNIEPACGEIDINGTQEMVFSFIPKQMGNQRKKFLLDIIGFEC
EINDCQQILYKKIVNKTYLFCCTGIGLYQKFPKPLNTTSLGSSLIDVVIDGEHQCSKNLQ
NTCEKSHKIKKKIVTDKKVNKNNTGGAEKVVNYTSVFNSMLGITSCSFVESRLLFGNIPL
NLTTTRSVLLKNDGKNHAYFQVINPSPLEGILIYPRENVIPVGGFVKLQISFKPTVPQKF
ETLLEIDVLSGKQISLRFSGVVDTPNVDISVVSIISCWFDSASGVYGGSISKLPFEIINL
VATYDFIIPCIVNDLDPMSIYFSSLYHKILKRVQGIALRQPLSISEKKLEFSLSSSYFEG
DLNNKNDCIQVICLKNISNETIKWSLDISNQPLVKQSIFILDVGNSVMHLKSGEEFNLAI
LFKPNLVQVYSYIELNGKVLLPKLVFQPEFIHIPPVPLCQITSAEVDVLAYNYTRFCELS
IYIPKIEFNGENFESLLSVELPNGSQIKKLHESETQVIKIIVKFVSAKPIFFSTQITLTD
KFTMELNNGSKKQTFTEPKIGRKQGKRPNLWKRFVKREKGMAYKTRKDASGDDKETLRPS
YDSHKFHEKEAMDEKNSDKTASAADKSIRSITFNLEAVLPLPFAGDAQIFYMRKLAIYNF
TIYETSTKKGICYLWDESDGKRGANEINTALLDYMKSLPVSVKKLSLGRNLGADTSIPVS
KLARICCSGQNRNQFIVATMMYIVQTTHLECIDMKYMESGHSYLEVDSMHSTIERTLPVP
KYLIDSSIPKAANFFLKQTMMVEVIFFFSLPVTASADNCLLTCSNFLINNQCDFHIICKE
GKKSNSGTSSLFVPCLSAIESAVAPSFSTSNTSLYTTTYQNSEPMGSSQFSDHSYSKISV
SIEKNFKTNNEIVEKECNIVQRWFSSQCWSFGSFPIYLPYTLRENFSVEVFIWRITNSSL
EGKVRFMNVFDLIAHLYGKSIPGITVKMLLSLKKEEDLVKCIVEMYLKMLTFLSYQGAIF
SSIKPEYFLNFSDFKRFKQLENCYESEKYHKSSDSFELLSKKSWTSLLLQIYKIYVLFRI
SPQICKSSFPFDYPTLPGFNSDPNCSNIYSSSERVILSWLNHHYEQQRIKCWKIAPPSRW
IVNFENDLVDGLVLASVIAAYAPFLVKTHIYKMYVQPSTTEQLHHNCLKIIEMLHILAID
YDIVTEDFIKSSPISMLMLCVYLIQNLPLYLPKSTIEFETSLHSLATKHIKITNPSGKPL
FYQALLFGDYSSQFQMPNGFKIQVPPKGFIELPVEYVSRFVHTCQCTLLLVGIRGEMVFG
STLAFCLKGTVNSLSVSNHFKYVSPCYELLKITVKVECPFPCNEIFKVFLVETGPVELGS
KITCRQKRILKKSYKKPELNQGIKNQYFESKPINLESKKKPLLSAFWCASKSIYIKTGLD
SSIELEFLPFEIGTRHCSILFSNEKVGDFLYLIEAESILPLPLGDPFINGPFRMTSAKAM
QQSSGTLKEDNHTIYLHCNAGEECVAEINFDYLNSGKERALVVAARQRMSDEELRRRDVT
GMTSYQTILSKVSLLQISRENYIQPLDVLNINNLQKEFKVEVSSPFFSAPDKVVIPNDSN
TSGLSSIKVPITLKPSIPGQYHCKVIFFSESDIRVYEIECTVKAKNSFVELEFVTPTHEC
VVQNIPFVNHSDFDWNMRSEITGEGFFGPECLVVLSKTTSYYPLSFKPIYEGTINGCLKL
CNISNGVENTFTLKGLGSQPHPVDVINIECIVNEPTLKVLELKNNLPFKMVFQTFSDLSI
ITGPLFVPVLSRQTVQVPIRVLALKRGYTEGVICFVYDVGSNTSVGVNRIRNESDGEEDY
NCTAFMSSLSVQLASLTLLEKIARPYRIWFQLNINAFPGKAVKTLFASSYIFSSTDIEIF
LNNPLDKDLNLNVVINGVGLDGITEFILPSLESITYHVKYSPTSIGKQKASVIFQSDLCS
EFWYELDLFAEEALPQKLPLIKCCLGCCKEASIHLENRYAYSVCYNVSCSDSKNFLLRGV
DDKLCLPPSCSIEVHFIFTPSSIGHHQGIVVFQNELIGNQTFILSGLGEAPELKYQFIHA
RFGESASTIIQFHNSFECSVSLEVQLQSENSDFSMLSKPYTGILCSSKSDVYIPISYSAQ
SMESSQCTCYIIPELIYEETEGEQFHDKMKFKWSYVVQGIPIIEPIKDSLAPALTCRARE
KLEKKIFILLIKESFISSRDKTCQHSVFPVRIFDHIDSFNNEAQLCEDFDFKLEFDNKEI
EDQVQRSVLITLEKKYIDCDYAAPNLVFKLVFFPSKPFCYLVHLAITSPKGGVWKYPFKF
VSNEAVPDDVIMIRAVGLNKTAHVSFRLNSQAEVESEFTAHISTGSDKMFEVTPQAGILA
PINTEGVLFTLSYKPLYYGKEHKTKLTVQSKLMQWIYEVRGVTPEYQPPKADAAIISHNK
TQKSNKKKNFVIKNLK
Download sequence
Identical sequences gi|449680276|ref|XP_002170657.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]