SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449681123|ref|XP_002166445.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449681123|ref|XP_002166445.2|
Domain Number 1 Region: 17-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.73e-30
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 2 Region: 954-1103
Classification Level Classification E-value
Superfamily Fibronectin type III 3.29e-26
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 3 Region: 379-566
Classification Level Classification E-value
Superfamily Fibronectin type III 7.98e-19
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 572-755
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 179-361
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000979
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 6 Region: 760-938
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000138
Family Fibronectin type III 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|449681123|ref|XP_002166445.2|
Sequence length 1188
Comment PREDICTED: protein sidekick-2-like, partial [Hydra magnipapillata]
Sequence
LVFIFGTSLLVLAEELCFTSLGASENGTLPSSAFTASSENDFFYKASHGRLGNAPSAWIP
KNFQPITDLYDEFLQINFQKMFTITGIATQGFTSGIFFVKTFFLKFSTDGEIFDDYLHTK
VLKIFEANVDTSGVVVQKLPCSVVAKYIQFVPLEFANGIALKVDVFGCGFTEEKDNQIED
YKVERVTTNGAEISWTQNSLDIEFFYIAYYPIGDSSSLIKYLVNPQNYKGTDKNIYIQSL
SGLFSCTDYQIRLSVYNKIGCGVPRVYSITTSTLPSKPIPPQKVEYEILQPETKSRIGYN
CAKFITNFKIEYRLHSTRSSYAVVQVSGSASFYNLTGLQGWQKYDIRIQSIGTYGESDYI
TYTISVEGKVPDQQIVITTLVSEEPQTILVKWQNPPVEKVNGYSVYFRVKSVPPLEWEHI
GLPSTATSIRISPTAKMLEPWKTYQVYISLYNIRHKLDSTIEEVLVKGKAPGLAPSNLVA
DIKLETKISLHWESVSMEYLPVIFQGYQMFYAEGNETLIKAHVYPSMETQRIMQNLKPGT
IYRFAVAAVSNNLLGPYSNILEVQTNHGQLNPPKINVASNCANTIFVEWFFAEDVFMSSL
TVSYKILGSGVWSSKVILSGKNNTIAQLEPWVEYEVQVELDSFGRKATSDIKKVLVIGEA
PGSAPKNLYATSVEESRIGLVWESIEPVFIPKVFNGYQVWAALDNESFYSASEFIMNTQY
TVRNLAPASSYKFKVTAISNKQFGPFSEVLSLSTLPIKAPLSPIITEVEKKPGKIKINWE
SRSNSRVPISLFIITLRDRKSLQENTTFHYTDSDAYDQRSFSRLIAVPPFTSFVITLKSC
IRDTCSPASDEMFITTMEDAPSHVLNLQVQETLDDVYVSWEPPIYVKGILRGYMVELIDP
LTNKIISTDIPDNTTNTKKYHGLPCYIDLIVRVKAMTALVGPAVNKTFRSPEGLPTAPTN
FKAILLKEDLMSVTWDSPSKANGVITKFKVVCIGTKSYNPSFISNYEEEVDFNIYVVRIK
GLQPGTTYKVQVSARTIKGYGEASLPRYFNTPVKAPPPPPIPITEKVSSSSIVIHLSPSA
DVNGPISAYQIIIEELESSLLNRVSRKRRSQELPQELHDYQTAKSLGHKFYITAEIDAIQ
VPSKFEVGDGVNYNGYLNAPLQPKTKYQLHVRGKIKSPEVIPFLFILK
Download sequence
Identical sequences gi|449681123|ref|XP_002166445.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]