SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|449685441|ref|XP_002158598.2| from Hydra vulgaris

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|449685441|ref|XP_002158598.2|
Domain Number 1 Region: 993-1105
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000811
Family Myosin rod fragments 0.0025
Further Details:      
 
Domain Number 2 Region: 2519-2780
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000105
Family Tropomyosin 0.0031
Further Details:      
 
Domain Number 3 Region: 1525-1748
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000036
Family Tropomyosin 0.00074
Further Details:      
 
Domain Number 4 Region: 2166-2371
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000719
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 5 Region: 3238-3514
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000235
Family Tropomyosin 0.0011
Further Details:      
 
Domain Number 6 Region: 345-597
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000353
Family Tropomyosin 0.00079
Further Details:      
 
Domain Number 7 Region: 1267-1515
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000015
Family Tropomyosin 0.0092
Further Details:      
 
Domain Number 8 Region: 2922-3114
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000131
Family Tropomyosin 0.0063
Further Details:      
 
Domain Number 9 Region: 1933-2027
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000811
Family Myosin rod fragments 0.0061
Further Details:      
 
Weak hits

Sequence:  gi|449685441|ref|XP_002158598.2|
Domain Number - Region: 3091-3238
Classification Level Classification E-value
Superfamily Tropomyosin 0.00153
Family Tropomyosin 0.0068
Further Details:      
 
Domain Number - Region: 1738-1928
Classification Level Classification E-value
Superfamily Tropomyosin 0.00248
Family Tropomyosin 0.0095
Further Details:      
 
Domain Number - Region: 870-984
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00314
Family Myosin rod fragments 0.0038
Further Details:      
 
Domain Number - Region: 16-263
Classification Level Classification E-value
Superfamily Tropomyosin 0.00501
Family Tropomyosin 0.0045
Further Details:      
 
Domain Number - Region: 1143-1240
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.0072
Further Details:      
 
Domain Number - Region: 584-699
Classification Level Classification E-value
Superfamily Tropomyosin 0.0222
Family Tropomyosin 0.0024
Further Details:      
 
Domain Number - Region: 2037-2132
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.0052
Further Details:      
 
Domain Number - Region: 2307-2500
Classification Level Classification E-value
Superfamily Tropomyosin 0.0575
Family Tropomyosin 0.01
Further Details:      
 
Domain Number - Region: 2752-2870
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|449685441|ref|XP_002158598.2|
Sequence length 3778
Comment PREDICTED: uncharacterized protein LOC100201149 [Hydra magnipapillata]
Sequence
MASENEQKDNTCNQLKNEKENFKRENEKLLRDIESFKTTFDSMSREKERMNKELSACNRR
STDLEVLIKRLQDENDSCKKALQTYEVRVPGLEEGLQKHKINQSVYAQEASALKQSNTRL
EKELQLMKDQHTTLHLHIGQYEDKQDAISNDLKAALGRIFELEALNEIVQRENEELKRNV
DNKYRILEEQLLTADHLNADLKNQLNEARMRYKKHTEDYRTIQREYHELQTRWDGSSNDA
AGKDRLMEQLRNDLKNARNELQVALHDAENYKSLVERIQEEHHELANELNDHKQRCYELE
GLYKSSEEEKDKILRDVTDWKSRCTDTETDFQVFQRDSDKEIRGLKAKIAKLEAHTDMVI
KDRDYTNDQLEAERAQSQKYKEEFERVQREYLEHQKVCERYADQILERDKIIEDLRNKLY
KMEVDMDIFKEQLSKAQTAEQIALQKKEKIEKKLNASEAKVKDLSDQNESLKNRIIELER
QNNALETQVDDLLKEIKALKDRVKDLDDVIRDSRNKIIYLETEINSIQHLLNDRDATIAK
LQSDLDNAHDQINSFRKHISELETTLDLLEQEKDDLQLQLNNSERQKDELKNNLDKVVQE
AQLIESELSALKQKLAKIEPQLRAANKQRDEYKNNNEHLKKKLQEAKDELSKTQRQLTDT
QRASDGLRKELRQKNQLLDEMRAKIATLTGQLQSARDELVHKNQEFDSLSDDYRSLQEEL
IRLRQRVGDLESANQMLAVEKDRLKEELIAFNNKYDDLKNKFEKSEYNRLEAQRQALAYE
QRLAKLEPQLQSILRENSELHLQVDKFAEELRIALEENRHLNRDIEELYRDRNEKLKQIY
ERDIIIEQLRAKIDLLENENNNLKQENDRLRGANDALENEKRSLQGKLNLANNRVKELED
QLEAAKRAKEDLQASLYELQKKYVTLETAHMKCSDREKELLKQISDLKQKLQALEDALND
EKLKNKQLEAENIHNQEQIRDLEALIDSLRQKISDDDKEIERLKAENDNLRHQLMAAKKQ
IDDLENQIGILEQEKNYLIEENDRLRQEVNRLESELDNLIKQKNNLANQLEDARKDLMRY
KEIILKLEGQIRDLQRTVESLQQEIFRKDRIIEKMDVKTHTYEVEIENLKNEIINREVLV
ESLDGTRQDFEIQIRNYNVRIESLEIRIEKLVVEKSELERNYQNAVNRANSLESQCQVLH
KERSDFKNDVERQFDDIRVEKEEFSRCQSELREVIKTVEIYHQEIIEKTTIIEKITIIRQ
EAEKERDNIKKECNQLKVEYNKLKDGVKRNQNELQAQIAKNTKIEKTITTLKSERDNFRL
KADAAHKQLVVIETQLKRSTERENRLHGELDTLTNKYNQLETSYQELLKQKNDLNAKLKD
LQGKYRDLETKYNKSLALNNDLKAQLKDALNTIADLKSQLEKEINDNRDLRDNFDSLKNQ
FDKLKDDYQRIERDLADYKFKYADATKEIAEKKNIIDDLTAKVANLEKQVVNYKQMVNQL
RMDYERSTREQNRLQEEIIKMQGTVSELENKLQKAELENDKLKKELNEVLAKLYLMEDEI
EDLRAKLQDAQAENRELRHDNIQLKEENQNIHKELEDTNLENKRVHEELRKRDELIAQLR
RARQEIENELELLKQDLTDKEKEIDDLFAKIQDLENTLQGLNTKLAEIEPAYEAARDKIK
RQEAGIKELKNKITDLESALKQSMENENEYKNRYELAQSKLGKITQFFEDEKQKVHELEK
KIEKLKGENDALTLQNEQFNSLNEKLEKENMQLNKNIEDIQHLLDQLQKQKTRAEKELEV
VVNNLEKMRNDFNINNRELNEKTRLLDGLGKKCDDIESALEKIKMEKATLEKENEALNLS
LNNLHAMSDAIQRRKEEVEREYFEARKKITELENLLSAAIDDKNDLTKHLNDELKKNSLM
EAEIRKLRQNDAQLQGEISESKARIHRLKLENANLKNANAELKRTIDRLNRENTEHQIAI
NGLNGQLKTIEGQANSLRKDLQDTKNTNNKLQKTIKDLEQELDRLKARGISNDLLIETLR
DEKERLQANLSAVEANYGELRDKYNNLLRDYGLLKDEHAFNEKRIKDLEIMITNLNGENE
RSKMLIAQLRKQIDGNEHEIQGLRREKMKLEQVSDIEIKISKAPEVDAVDNNAALRNIDE
LRKQLEISEIAKAAAENERDALLKEHVSLHKKITKLEVIIESTSSKREEYKQALAAMERK
VKELEGINNRLTDREKELQSELLNAHKEMTNLQQEVIVLKVKLSKSEGDRSSLEGKVQKY
FNEINDLHQKLAEVQSSIEEKDAVIQNLREELNSERKNYAQLESEIEILRDEHDKLQMQI
SNLQRKAEEYERVIHDNEIKYSQLMRQLDEQNARGKRLRDENAELHRSIGEKEQIIERYK
QEVNEKQSLVDKLTNEKNKLENELEGLKQELGAIKNDREKLRLDNRTQKQDNQTLQLKIM
ELESEKEILKDQISRLSKDIDNLRNSMQQIKDENNRLISENKKFKHEISLNNRKADIPSD
YDSLKDQKDNLLNQLKELTKESNDLKGKCAALKSNKKGLLKKIEDIEAYLADKDLRIQKL
EAEKADIERDIDAGKSKMNKLEWAADNLEREKKELQNELAEIHKKHSKVEGDYYMACEKR
DDLQKELNNALEKINQLEENIKRLQNRESKLHADMLEAQKKVTILEHEIASAKDKNDTLQ
RAYKQIEDKQNTLNGELMAARKRISELEAFQEISEDLKKEFQGEIDSIKRRYNELKESNQ
ILKLEKEGLLLEIQNITSKISKFENKLMQAQKEKEYLESQLEDARHRATIDREEIMGLQK
QILDAQRKYESAVKEIAHFKSTTDELRSKNIALSNEFESFMRDLENKQYEVDASENDKKS
LREELELSRKRYSDLEAEYLHVQEEKEKIRQDMIASHLSVCKLKEKYENSLTDKNKLRDE
LTIFHRKITELTSSYDTCRSERERYKLDCEKFQAQYDAIKNQHDVSQHSANQTKNDFESL
NKKSQKIEQSYIVLEREKDRLQKELLDTHRKSADIALALQTCQEEKRSIEFQVKDLTDEL
EKARSDIDSQNSKINYLQEEILIHHKQYAKIETNYNRLVEKEERLEKELEDARANVYKLE
SELSDVLKKNQYLDSELRKAEDLVNKQKDNSQLYSEDTQRMQTKIREFESKFSQLKDAED
ENKTLKEDNNLFKSQITRLEVEIRSERNKHQTLSDQYEQAKFKHENLDKEISALQKQIRL
EKEMAEKNINELKKSVQEKESDAERLRSNVRKLEIEMNALKTQVNQTKSEYDDISRIRHI
IEQELQNISKKLANFEITFITVEDDSERKYAGLSDYERYLSEINRVFTRTEKEFQHQEMR
HKYLEDQKEQERKGKSNAQTEIEDLKRRVEVLKREKVTMENEKKIMTELNSDWDSKYKNL
AKEFHTSQIRCEELQKEINTYKFEISQFQNQASTIEKKYNESGQSMKDLEARLETALRNT
ATLKNELNEEKLRLKEAKKDNEKQVRELYKTIEEYGKTIKEKETTIEEMRSKKGNNEQES
DQLRWQLTKSKDDLKEVQKERDQLKEKVQQNQAVIAKLEKSAEKFKHLRITIEEEHRIVV
EKYVKEIKEITIKLIKVEKELQKATELNKTENDERYKRLQHLLQDERDEFRQKLHAKEHE
VDSYKIIVSQKQEKIRKLKRTIVDLEARIAQQSATHSSSMLISTKPHLKHESKYFHETSE
IIVGQRRQDVPHQESKYFHETSEIHISQQQTGSISQESKYYRDTAQVQVVPKRIESKK
Download sequence
Identical sequences gi|449685441|ref|XP_002158598.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]