SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Walse1|53868|estExt_fgenesh1_pm.C_50022 from Wallemia sebi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Walse1|53868|estExt_fgenesh1_pm.C_50022
Domain Number 1 Region: 119-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.52e-103
Family GABA-aminotransferase-like 0.0000000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Walse1|53868|estExt_fgenesh1_pm.C_50022
Sequence length 610
Sequence
MNLRNISRYRSFCPFLGSNTTKQLSTLSRTTSNGFTSNLTTKAQSCPVMGPAMQQQKKHY
ASVASKKDVDAIHAKEGVKKSSGGVCPHAAAGIAAAKAAAAAANAPIPQPAQPSTSNALF
NYEEFYANQLQKKHDDASYRYFNNINRLAQKFPVAHTSRPDEEVTVWCSNDYLGMGKNQI
VIDTMKKTLDKYGAGAGGTRNIAGNGQLHLSLEAELASLHRKEAALVFSSCYVANDATLS
TLGSKLPGCVIFSDSQNHASMIQGIRHSGAKKEIWKHNDLNDLEARLRKYPKETPKIIAF
ESVYSMCGSIGPIREICQLAKKYGAITFNDEVHAVGMYGPTGAGVAEHLDFQSHSKTSEA
VKGSVMDQVDIITGTLGKAYGVVGGYIAGSADFIDMIRSYAPGFIFTTSIPPAIAAGAQA
SIAYQKAYRGDRIKQQINSRNLKNKLRDVDIPVVPGPSHIVPVLVGDAALAKQASDSLLV
DHGVYMQALNFPTVAVGEERLRITPTPGHSIEAMDHLVRSLDEVWNKLSIPRESDWIKMG
GRAGVGQPELVDAESLWTDSQLGLLGENHHVPDIFNFDVEQAKQIATERLQELLDQHADD
DIVRIINGSE
Download sequence
Identical sequences I4YEY9
XP_006957203.1.58810 jgi|Walse1|53868|estExt_fgenesh1_pm.C_50022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]