SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Walse1|60298|estExt_fgenesh1_kg.C_80122 from Wallemia sebi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Walse1|60298|estExt_fgenesh1_kg.C_80122
Domain Number 1 Region: 48-494
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.68e-111
Family Pyridoxal-dependent decarboxylase 0.0000000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Walse1|60298|estExt_fgenesh1_kg.C_80122
Sequence length 531
Sequence
MPLSKHIDTDKLIEQSRDDKARKLVQRASGEDSRKYASSPLFGRYGHAPLPKYQFPEKGV
DEHIAYQLIHDELSSDGTPLLNLASFVTTRQPESANKLILENLNKNIADQDQYKASFELQ
TRCVSMLADLWKVPKGNSAIGTITAGSSEGLLLGGLALKKIWQEKVKNATPKRSFKEPGP
NIIFASEAHCCVEKFARYFDVEARILPISKKSKYTLDPALVYEQCDENTIGVILIAGSTY
TGHVEDVLGVNNVLDKVQREKGYDIPIHVDAASGGFVLPFAFPSHKWAFNVPRVVSINAS
GHKYGGVYVGAGVVLWRDEKLLPKELIFEMHYLGSTELSFTLNFSRPATPVIAQYYNFIN
LGFEGYKTILENDLANARMLARALEASGYFEVLSDNHRPADGRKTDDNSLAEFYTPSLPV
VAFKWTDKFKSEHPHLEQKWLQILMKTKGWILPNYAMAKDLEDIEIVRAVIREELSEDML
DILVKDLVEVQESLTDMTSDFYKLAHAGSSKGPAEDNKKQDRSHQGYSRPC
Download sequence
Identical sequences I4YD63
jgi|Walse1|60298|estExt_fgenesh1_kg.C_80122 XP_006958201.1.58810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]