SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Walse1|66787|estExt_Genemark1.C_10068 from Wallemia sebi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Walse1|66787|estExt_Genemark1.C_10068
Domain Number 1 Region: 4-128,260-398
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.18e-60
Family Capz alpha-1 subunit 0.0000798
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Walse1|66787|estExt_Genemark1.C_10068
Sequence length 406
Sequence
MSSTEIVKKILKQSPPNELNDVLEDLKVLTDIDQDTLDTCLKEYNEEQFNSIDLDGVRTL
ITPHSHFEGEKYYDPKSSKLFTLNQLELKTNSAEEVDQLSYKNEARSLLEKSLDSYVEEY
FSNGTAAVYTSLKNIQGSLQSQEEQDTVEEAKDSDSNKETARNTENTEMTEAEHGTEEEQ
NEDNKDKEDKEEQKKDNEDVETPQEQEQEQKEDNEDAEKPEEQPEEPVEDKPIEESKEPE
GSVPAETTQVHQETTEDTTENTPSEEITSMNICYAGNKFNQSNYWSGRWRANWVYDLTTN
ELIGNINITIHYFENGNVQLQASHNPKIKSPLEGPPTTEEEAKKLVKAISESDRAYQAYI
NVLYEDKLSEKLFRSLRRALPITREKINWDKVVNYKLGSELGKLNN
Download sequence
Identical sequences I4YIV7
XP_006955741.1.58810 jgi|Walse1|66787|estExt_Genemark1.C_10068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]