SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Walse1|68673|estExt_Genemark1.C_80013 from Wallemia sebi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Walse1|68673|estExt_Genemark1.C_80013
Domain Number 1 Region: 115-424,471-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.85e-67
Family GABA-aminotransferase-like 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Walse1|68673|estExt_Genemark1.C_80013
Sequence length 529
Sequence
MYNELEGIAHYLQQLPGSSIFIRYVKSSYQNDPWRSLLELLLFLFALRVWLSKRTRRDAE
KGFVGLSSTEIDELVDDWQPEPLVPQAEIKQAPTIIGPPSIKPKVSQPGQPSDKARQVTN
LVSYNFLGLLGDQRIKDAATKALRVYGVGSCGPPGFYGTMDVHIDLEKSIAQTLGTESAI
IYSQGFATITSVIPTFAKRGDIIVADEGCSFAIRKGLQISRSTVRWYKHNDMNSLETVLD
SINREAKRRKAPLTRKFICSEGIFQNDGSLANLKRIIELKKKYKYRLILEESYSFGVVGN
TGRGMTELYDIPAKEVDILVGSMANTLGSAGGFCAGESVVVEHQRINSAAFIFSASLPPM
LAVSANETLSILNSSSGPNIVHSLQTNIASFRSVLSTIDSIELASHALSPIQHVFFSQSK
ELQIISTSQKEKSSEEERVEAVLGDICDDALVNGVFITVAGHLRGQESDIGALSAGSTGI
RVAPGGAPPPTEPRASIKIAISSALSKKETEKAALVVKNSINRVLKRRA
Download sequence
Identical sequences I4YCP5
XP_006958048.1.58810 jgi|Walse1|68673|estExt_Genemark1.C_80013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]