SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|138025|estExt_fgenesh1_kg.C_5_t20022 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wolco1|138025|estExt_fgenesh1_kg.C_5_t20022
Domain Number 1 Region: 34-245
Classification Level Classification E-value
Superfamily ITPase-like 7.85e-40
Family Maf-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|138025|estExt_fgenesh1_kg.C_5_t20022
Sequence length 258
Sequence
MFNLFGSKNISLPKHNCVLPHALRLESLNKLVGKRVILASNSPRRKEILQIFGFVPEIIP
STFEENLPVSSFEDIHEYPVATASHKAVEVYERLVQENPDDAPDLVIGADTVVLTHQMPG
LSSIAPEDTPFSSQDLLEKPVSKEDNLRMLLDLNGGVCEVVTGISLVYPVLEAPGYKIKS
IEERTLVHFADNSQELLQAYVDSGEGLDRAGGFAVQGLGGILVRKVDGDYQNVVGFPAAS
FFKFLDLLLEEESDFLAV
Download sequence
Identical sequences A0A2H3JXV7
jgi|Wolco1|138025|estExt_fgenesh1_kg.C_5_t20022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]