SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|86283|e_gw1.117.1.1 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Wolco1|86283|e_gw1.117.1.1
Domain Number - Region: 7-70
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 0.000117
Family Holo-(acyl carrier protein) synthase ACPS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|86283|e_gw1.117.1.1
Sequence length 80
Sequence
SAHAGRFAVAVYMFKSLGVSSKGAGAAMKNIEILPDETGAPTVALHGPEAKAAANAKGIT
KVHISLSHSEVRYHTGNRGV
Download sequence
Identical sequences A0A2H3IZS1
jgi|Wolco1|86283|e_gw1.117.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]