SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|134948|estExt_fgenesh1_kg.C_1_t10144 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wolco1|134948|estExt_fgenesh1_kg.C_1_t10144
Domain Number 1 Region: 244-391
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000013
Family CBS-domain pair 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|134948|estExt_fgenesh1_kg.C_1_t10144
Sequence length 491
Sequence
MLALLLLGICPVLASPTSPTEVPAGKPGEPPGSSAFLYKLIISVGLVLLGGVFAGLTLGL
MGLDELHLRVLAASSDDPKERQDAQKVLGLLTHRRHWVLVVLLLGNVIVNESLPIFLDSA
LGGGLAAVVISTTMIVIFGIIPQAASVRYGLSIGASCAPIVLAMMYLFAPIAWPIAKLLD
YILGSNDSHTYKKAELKCVFRSLTHSHERFAFDVSQSTAVSDRSFLAFHRHGEEPLRDDE
ISILNGVLELNQKHVDEIMTPMADVVTISTDAVLDHDNVDRILRSGYSRIPVHKAGRPLA
FVGLLLIKKLSVYDPSEALPVSEFPLSILPEAKPTINCFQALDYFQTGRAHLLLLSNTPG
VEGGAIGVVTLEDIIEEIISEEIVDETDRYEDNHSKRRARRLKNQAVMRGIVEYRASRAN
SDTMLPLVTERTLLIGPKNNENTRENGNGANDAKDGEGERSALSRSPTGVDSSTYGSVTV
GSPLDMQGSGQ
Download sequence
Identical sequences A0A2H3ITU5
jgi|Wolco1|134948|estExt_fgenesh1_kg.C_1_t10144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]