SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|140200|estExt_fgenesh1_kg.C_130167 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wolco1|140200|estExt_fgenesh1_kg.C_130167
Domain Number 1 Region: 6-491
Classification Level Classification E-value
Superfamily Clc chloride channel 2.62e-108
Family Clc chloride channel 0.0000899
Further Details:      
 
Domain Number 2 Region: 494-567,609-673
Classification Level Classification E-value
Superfamily CBS-domain pair 2.76e-23
Family CBS-domain pair 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|140200|estExt_fgenesh1_kg.C_130167
Sequence length 718
Sequence
MRVAEAGQSWFVAGLAGMCIGINAALISIITAWLSDLKMGYCSDGWWLNRQFCCWEIEGD
SDGCDSWHPWSPAWAVRWIVYTIFASVFSFTAAHLVRSIAKYAAGSGISEIKCIIGGFTM
KGYLGFGTFFIKSMTLPLVIASGLSVGKEGPSVHVACCIGNLVASLFSRYSRSQGKMREI
LTASSAAGVAVAFGSPIGGVLFSIEEMSSIFSIKTMWRSFVCALMATATLSAMNPYRSGK
LVLFQVTYDRDWHFFEIIVFVILGIFGGLYGAFVVKFNLQVAAFRRKYLGSFPVSEAVLL
ATITALVGWFNRFIRIDMTESMSILFRECQGGGDYDNICQTSEQWTMVNSLFLATVLRIG
LVIISYGCKVPAGIFVPSMAIGATFGRMIGIMVKALYRAYPRSSMFAVCQMDVQCITPGT
YAFLGAAAALSGIMRLTVTVVVIMFELTGALTYILPTMIVLLVTKAVGDFLGTNGIADEM
IRFNGYPFLERDDESYNVPVSRVMKRDIRTLPASGLRVRDIEDRLASTQIKGFPIVSADG
TGLLVGYIERADLRHILDKAPHVQDISPDTPCSFLPDEGDQNHASLRVDIPGIAAGPAVG
VDDDISMEIIETIAIPNVLKFWPWVNRTPLTVAPQLPLEVVMQLFKRMGPRVILIEDHEV
LSGLVTVKDVLRFTVTEQSPARSPWDEREFEGIIEEVWTWTYGRAHAFVSLCRGFVRR
Download sequence
Identical sequences A0A2H3J2X0
jgi|Wolco1|140200|estExt_fgenesh1_kg.C_130167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]