SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Wolco1|23960|fgenesh1_kg.3_#_387_#_isotig11472 from Wolfiporia cocos MD-104 SS10 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Wolco1|23960|fgenesh1_kg.3_#_387_#_isotig11472
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily YjgF-like 1.73e-37
Family YjgF/L-PSP 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Wolco1|23960|fgenesh1_kg.3_#_387_#_isotig11472
Sequence length 125
Sequence
MKTCVKSEEAVPPLPQFSHATISNGTVYVSGSIGSDKDWNLAGDIKAQTRAGIQNMEKIL
QAAGSGLDRVLKCTVFLTNLKEDFKPMNEVYSEFFHTNPPARTCIGVAQLPMGAAFEIEC
IAEVS
Download sequence
Identical sequences A0A2H3JN98
jgi|Wolco1|23960|fgenesh1_kg.3_#_387_#_isotig11472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]