SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384213985|ref|YP_005605148.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384213985|ref|YP_005605148.1|
Domain Number 1 Region: 1-421
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.37e-121
Family Cystathionine synthase-like 0.00000000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384213985|ref|YP_005605148.1|
Sequence length 433
Comment O-acetylhomoserine sulfhydrylase [Bradyrhizobium japonicum USDA 6]
Sequence
MRNETIAIHAGYEPEATTHAVAVPIYQTAAYAFDSADHGAALFNLEAEGFRYSRIANPTS
AVLEKRIAQLEGGVGALAVATGQAALHFAFVNVADHGGNIVSVPQLYGTTHTLLSHILPR
QGITGRFAESDKPDAIAELIDENTRAVFAETIGNPAGNVCDIEALAKIAHAHGVPLIVDN
TVATPILLKPFDYGADIAVHSLTKFLGGHGTTLGGAIVDSGNFPWASHADRFPAYNKPDA
SYHGLVYAERFGRTAYIERARSVYQRTMGSVLSPFNAFLLLQGIETVALRMERHVGNARK
VAEFLRKDSRVAWVNYTGFPDSPYYPLVQKYLDGNASSLFTFGIKGGMEAGKTFYDALKL
ITRLVNIGDAKSLACHPASTTHRQMSAEQQRVAGVLPETIRLSIGIEHSADIIEDIDQAL
EKACPSARLQAAE
Download sequence
Identical sequences G7DDH3
WP_014490461.1.18950 WP_014490461.1.35620 WP_014490461.1.77977 WP_014490461.1.97209 gi|384213985|ref|YP_005605148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]