SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384215591|ref|YP_005606757.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384215591|ref|YP_005606757.1|
Domain Number 1 Region: 2-398
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.65e-114
Family AAT-like 0.000000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384215591|ref|YP_005606757.1|
Sequence length 400
Comment aspartate aminotransferase A [Bradyrhizobium japonicum USDA 6]
Sequence
MSFLAAALDRVKPSATIAVTDKARALKAAGRNVIGLGAGEPDFDTPANIKLAAIHAIEAG
KTKYTAVDGIPELKEAIIGKFQRENGVTYKPNQIIVGTGGKQVLYNALMATINPGDEVII
PAPYWVSYPEMVALAGGEPVPVVCTAATGFKLQAEALERAITPKTKWVILCSPSNPTGAA
YTRTELKALTDVLVRHPHVWVMTDDMYEHLVYDDFQFTTVAQVEPKLYDRTLTVNGVSKA
YCMTGWRIGYAGGPAQLIKAMSTIQSQSTSNPSSIAQWAAVEALNGPQDFIPANNKVFKE
RRDLVVSMLNQAKGIECPRPEGAFYVYPSCAGTIGKTAPSGKVIDNDETFVTELLETEGV
AVVQGSAFGLGPAFRISYATKTSDLEDACKRIQRFCGNLR
Download sequence
Identical sequences A0A0A3Y6Y5 G7D4T0
gi|384215591|ref|YP_005606757.1| WP_014492041.1.18950 WP_014492041.1.35620 WP_014492041.1.67973 WP_014492041.1.77977 WP_014492041.1.85912 WP_014492041.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]