SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384215609|ref|YP_005606775.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384215609|ref|YP_005606775.1|
Domain Number 1 Region: 10-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.74e-72
Family Cystathionine synthase-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384215609|ref|YP_005606775.1|
Sequence length 390
Comment phosphoserine aminotransferase [Bradyrhizobium japonicum USDA 6]
Sequence
MTVAKPASRPNVPHFSSGPCAKRPGWNAQNLKDAALGRSHRAKVGKTKLKLAIDLTREVL
EVPADYRIGIVPASDTGAVEMALWSLLGARPVTTLAWESFGEGWVSDIVKELKLKDVTKL
NAAYGEIPDLSKVDPKSDVVFTWNGTTSGVRVPNADWISATREGLTICDATSAAFAQPLD
WAKLDVVTFSWQKALGGEAAHGMLILSPRAVERLETYKPAWPLPKIFRMTKGGKINEGIF
VGETINTPSMLCVEDYLDALNWAKSIGGLKALIARADANTKVLADWKAKTPWIDFLAKDA
AIRSNTSVCLKFTDPAITSLSEDAQADFSKKLVALVEKEGAGYDFAYYRDAPAGLRIWCG
ATVEAKDVELLTQWIDWAFAETKAQLAKAA
Download sequence
Identical sequences A0A023XQY0 G7D4U8
gi|384215609|ref|YP_005606775.1| WP_014492059.1.18950 WP_014492059.1.35620 WP_014492059.1.64673 WP_014492059.1.6944 WP_014492059.1.77977 WP_014492059.1.97209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]