SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384215893|ref|YP_005607059.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384215893|ref|YP_005607059.1|
Domain Number 1 Region: 81-151
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.41e-28
Family CO dehydrogenase ISP C-domain like 0.00051
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.64e-26
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384215893|ref|YP_005607059.1|
Sequence length 154
Comment hypothetical protein BJ6T_21920 [Bradyrhizobium japonicum USDA 6]
Sequence
MATTLTINGETKSFDAPPEMPLLWVLRDILGMTGTKFGCGVAQCGACTVHVDGKAVRSCV
LPVSAVANRAITTIEAVGNTPSGAKVQKAWLDAEVIQCGYCQSGQIMAAAALLATTPHPD
DSDIDAAMAGNICRCGTYVRIREAIKQAANGRQS
Download sequence
Identical sequences G7D7H4
gi|384215893|ref|YP_005607059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]