SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384216295|ref|YP_005607461.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384216295|ref|YP_005607461.1|
Domain Number 1 Region: 13-406
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.56e-111
Family AAT-like 0.000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384216295|ref|YP_005607461.1|
Sequence length 408
Comment hypothetical protein BJ6T_25950 [Bradyrhizobium japonicum USDA 6]
Sequence
MTVQAPTSTFRPAQRIGAIGVSEILKIGAVAQRLKREGRPVIVLGAGEPDFDTPDHARDA
AVRAIRAGQTKYTILDGTVELKAAIAEKFRRENDLVYAADEITAGAGAKQVIHNAFMASL
SPGDEVILAAPYWTSYADMVRIADGTPVDVPCREENGFRLDAANLERAITPKTRWLLLNS
PSNPTGAAYSAAQLRPILDVLKRHPHVWLMADDIYEHLIYDGMPFATAAALEPSLKSRTL
TVNGVSKAYAMTGWRVGYGGGPRELIAAMAVVQSQSTTNPSSVSQAAAIAALTGPQDVLI
ERRAAFQRRRDIVVDALNAIDGVTCRLPEGAFYTYASCAGLIGRRTPDGTLIDSDAAFCR
FLLERHDVAVVPGSCFGLAPYFRLSYATSEQNLREAVMRIAKACRELS
Download sequence
Identical sequences G7DBU5
WP_014492731.1.18950 WP_014492731.1.35620 WP_014492731.1.77977 WP_014492731.1.97209 gi|384216295|ref|YP_005607461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]