SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384217243|ref|YP_005608409.1| from Bradyrhizobium japonicum USDA 6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384217243|ref|YP_005608409.1|
Domain Number 1 Region: 283-905
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 7.2e-176
Family Molybdenum cofactor-binding domain 0.000000115
Further Details:      
 
Domain Number 2 Region: 152-300
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 3.14e-43
Family CO dehydrogenase molybdoprotein N-domain-like 0.00024
Further Details:      
 
Domain Number 3 Region: 81-145
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 5.5e-23
Family CO dehydrogenase ISP C-domain like 0.0005
Further Details:      
 
Domain Number 4 Region: 2-85
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.54e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384217243|ref|YP_005608409.1|
Sequence length 908
Comment dehydrogenase [Bradyrhizobium japonicum USDA 6]
Sequence
MSFEVNGKAFPQEPRAGQCLRTFLRELGHFGVKKGCDAGDCGACTVLLDGEPVHSCLIPA
FRAEGRAVTTIEGLAGDHGAHPMQQAFLDAQGFQCGFCTAGMILTCASLNQAQRTDLGSA
LKGNICRCTGYRSIEDALLGKTNVEESVEPGAAFGRSLPAPAGPDVVRGKAHYTFDTQID
DLLHIKLLRSPHAHAKIVAIDKSDALRVPGVHAVLTHEDAPSVLISTARHEKDWMDPEDT
RILDDVVRFIGQKVAAVVAESEAAAEEACRRLKVSYEILPALIDPEQAMAPGAPVIHPDR
TTANRIADPQRNLAAETHGEYGDVAAAFATSAVTYEATFHSHRVQHAALETHGGLAWLDA
SGVLNVRTSTQVPFLTRRALSDIFGLPMDKVRVFCERVGGGFGGKQEMFVEDILALAALK
TGRPVKLELTREEQFIATSTRHPMRVHIKAGADADGRLTALQLEVLSNTGAYGNHAGPVM
FHSLSESIAVYNCPNKKVDGFAVYTNTVPSGAFRGYGLPQTQIAIEAAIDELARQLGISP
YDMRRRNVVKTGDPMLSPPPSEFHDVLYGSYGLDQCLDLVERAMQADGPQPDLSPEWLIG
DGVALTMIDTVPPAGHLADAMIALNDDGGFDLTVGTAEFGNGTSTVHRQIAATTLATTVD
RIRLRQSDTAHGGHDTGAYGSAGTFVAGKATHAAAMQLATELKAVAAGAWLCDAASCTLD
DEAVVSGVRRMSFTELAKLARERGQPFAASGNSEGTPRSVGFNVQGFRVAVNKGTGEIKI
LRSVQAADAGVVANPMQCRGQVEGGVAQAIGAALYEEMVIDATGRVTNPKFRDYHLPSFA
DVPRTEVFFAETSDTIGPLGAKSMSESPYNPVTAALGNAITDATGIRFTAPPFKPDQLFP
ALHAKFGN
Download sequence
Identical sequences G7DLF5
WP_014493675.1.18950 WP_014493675.1.35620 WP_014493675.1.77977 WP_014493675.1.97209 gi|384217243|ref|YP_005608409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]